Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.00
PubTator Score 1.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.900 4.4e-06
astrocytoma -1.100 2.3e-07
cystic fibrosis 1.897 1.6e-06
ependymoma -1.600 7.0e-06
glioblastoma -2.700 1.2e-06
group 3 medulloblastoma -2.100 1.2e-03
medulloblastoma, large-cell -2.500 2.8e-04
ovarian cancer -2.700 4.9e-09
pituitary cancer -1.300 3.2e-05
psoriasis -1.400 1.0e-31
subependymal giant cell astrocytoma -2.498 1.1e-02

Gene RIF (2)

AA Sequence

MHTCCPPVTLEQDLHRKMHSWMLQTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENRGI      1 - 70
ISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDIETGAFHGLRGLRRLHLNNNK     71 - 140
LELLRDDTFLGLENLEYLQVDYNYISVIEPNAFGKLHLLQVLILNDNLLSSLPNNLFRFVPLTHLDLRGN    141 - 210
RLKLLPYVGLLQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSK    211 - 280
QELCPRRLISDYEMRPQTPLSTTGYLHTTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPS    281 - 350
KDLGYSNYGPSIAYQTKSPVPLECPTACSCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENY    351 - 420
IAVVRRTDFLEATGLDLLHLGNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGLQSLQYLFLQY    421 - 490
NLIREIQSGTFDPVPNLQLLFLNNNLLQAMPSGVFSGLTLLRLNLRSNHFTSLPVSGVLDQLKSLIQIDL    491 - 560
HDNPWDCTCDIVGMKLWVEQLKVGVLVDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVSTPTPSSIQV    561 - 630
PARTSAVTPAVRLNSTGAPASLGAGGGASSVPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHT    631 - 700
STNNSDVSSFNMQYSVYGGGGGTGGHPHAHVHHRGPALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREG    701 - 770
NSVEDYKDLHELKVTYSSNHHLQQQQQPPPPPQQPQQQPPPQLQLQPGEEERRESHHLRSPAYSVSTIEP    771 - 840
REDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKFPCSPAAYTFSPNYDLRRPHQYLHPGAGDSR    841 - 910
LREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF                          911 - 958
//

Text Mined References (11)

PMID Year Title