Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.24
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -2.127 1.1e-03
adult high grade glioma -4.900 2.6e-07
aldosterone-producing adenoma -1.572 6.9e-03
astrocytic glioma -3.400 1.2e-03
Astrocytoma, Pilocytic -2.300 1.4e-04
Atopic dermatitis -1.900 4.0e-05
atypical teratoid / rhabdoid tumor -5.900 1.9e-14
ductal carcinoma in situ -1.100 3.3e-03
ependymoma -3.800 4.9e-04
glioblastoma -4.200 2.8e-09
group 3 medulloblastoma -2.900 8.5e-03
medulloblastoma, large-cell -5.500 8.8e-08
oligodendroglioma -3.200 3.5e-03
osteosarcoma -1.811 1.6e-03
ovarian cancer -1.200 1.0e-03
primitive neuroectodermal tumor -3.900 5.0e-05
psoriasis -1.100 2.8e-21
subependymal giant cell astrocytoma -3.384 1.3e-02
tuberculosis 2.000 9.9e-07

AA Sequence

MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNF      1 - 70
LNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADY     71 - 140
NLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQL    141 - 210
EDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQL    211 - 280
ENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKT    281 - 350
HPSDLGLSVNCQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDV    351 - 420
FHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEISAGTFDSMPNLQLLYLNNNLLKSLPV    421 - 490
YIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWVEKLSDGIVVKELKC    491 - 560
ETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLIL    561 - 630
TVFVAFCLLVFVLRRNKKPTVKHEGLGNPDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTC    631 - 700
GLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN    701 - 770
SIGVSGFEIRYPEKQPDKKSKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI       771 - 837
//

Text Mined References (12)

PMID Year Title