Property Summary

NCBI Gene PubMed Count 34
PubMed Score 511.64
PubTator Score 40.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.700 1.3e-03
ependymoma -3.100 2.5e-07
oligodendroglioma -1.600 6.5e-16
glioblastoma -3.700 2.7e-04
group 4 medulloblastoma -3.500 3.5e-05
atypical teratoid / rhabdoid tumor -3.400 9.6e-05
medulloblastoma, large-cell -2.700 1.9e-02
primitive neuroectodermal tumor -1.900 4.0e-02
pediatric high grade glioma -2.800 2.5e-04
pilocytic astrocytoma -1.100 4.7e-02
subependymal giant cell astrocytoma -2.151 5.0e-02
psoriasis -1.500 1.4e-03

Gene RIF (23)

PMID Text
26317387 Data provide partial support for the implication of SLITRK1 in the pathogenesis of Tourette syndrome.
23990902 the N400I variant of SLITRK1 may have a role in obsessive-compulsive disorder
23528612 One of the few genes that has been linked to TS is the SLITRK1 (Slit and Trk-like 1) gene, where four variations have been suggested as possible disease-associated changes
23333760 The study of chromosomal aberrations in Tourette syndrome etiology has implicated multiple genes, with SLITRK1 being the most prominent example.
21458401 DM1 motoneuron/muscle cell cocultures showed alterations that are consistent with the known role of SLITRK genes in neurite outgrowth, neuritogenesis, and synaptogenesis; functional defects can be directly attributed to SLITRK misexpression.
20351724 The study of this study support that SLITRK1 var321 is association to Tourette syndrome.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19018236 results provide no evidence for SLITRK1 playing a major role in Tourette disease
19018236 Observational study of gene-disease association. (HuGE Navigator)
18722020 We report the psychopathological features in a large Italian family with Gilles de la Tourette syndrome not linked to the SLITRK1 gene.
18698576 These findings provide the first support for the original finding indicating SLITRK1 as a susceptibility gene for Gilles de la Tourette Syndrome
18413575 Observed transmission is lacking of SLITRK1 var321 from an affected parent to a child with Tourette syndrome in two families segregating this variant.
18021920 Genetic screening in the Slit and Trk-like 1 gene for the recently identified mutations does not appear to be of utility in the diagnosis of Tourette syndrome.
18004766 identified four new variants for Gilles de la Tourette syndrome
17712845 negative results of the SLITRK1 analysis point to genetic heterogeneity in Tourette syndrome
17671968 Observational study of gene-disease association. (HuGE Navigator)
17083340 Observational study of genotype prevalence. (HuGE Navigator)
17035247 Observational study of genotype prevalence. (HuGE Navigator)
17003809 Rare variations in SLITRK1 result in disorders of the obsessive-complusive disease spectrum
16936762 No variation in patients susceptible to obsessive-compulsive disorder.(
16323357 SLITRK1 trouble in Tourette's syndrome.
16224024 Observational study of genotype prevalence. (HuGE Navigator)
16224024 findings support the association of rare SLITRK1 sequence variants with Tourette's syndrome

AA Sequence

MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSL      1 - 70
TRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKRLHINNNKIKSFRKQTFLGLDDLEYLQADFN     71 - 140
LLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLE    141 - 210
DNPWDCTCDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEET    211 - 280
FAPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGSSRNKPLANSLPCPGGCSCDHI    281 - 350
PGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFK    351 - 420
NLLDLRWLYMDSNYLDTLSREKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDV    421 - 490
FAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSEVLMSDLKCET    491 - 560
PVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVT    561 - 630
SAFTVVGMLVFILRNRKRSKRRDANSSASEINSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD        631 - 696
//

Text Mined References (33)

PMID Year Title
26317387 2015 Analysis of SLITRK1 in Japanese patients with Tourette syndrome using a next-generation sequencer.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23990902 2013 Characterization of SLITRK1 variation in obsessive-compulsive disorder.
23528612 2013 Sequence analysis of SLITRK1 for var321 in Danish patients with Tourette syndrome and review of the literature.
23333760 2013 The genetic basis of Gilles de la Tourette Syndrome.
23326512 2013 Genome-wide association study of irritable vs. elated mania suggests genetic differences between clinical subtypes of bipolar disorder.
22365631 2012 Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.
21458401 2011 Mutant human embryonic stem cells reveal neurite and synapse formation defects in type 1 myotonic dystrophy.
20351724 2010 Additional support for the association of SLITRK1 var321 and Tourette syndrome.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19018236 2008 Sequence analysis of the complete SLITRK1 gene in Austrian patients with Tourette's disorder.
18722020 2008 Psychopathological features of obsessive-compulsive disorder in an Italian family with Gilles de la Tourette syndrome not linked to the SLITRK1 gene.
18698576 2009 Association of SLITRK1 to Gilles de la Tourette Syndrome.
18413575 2008 Lack of association between SLITRK1var321 and Tourette syndrome in a large family-based sample.
18021920 2007 Association of the Slit and Trk-like 1 gene in Taiwanese patients with Tourette syndrome.
18004766 2008 Haplotype evolution of SLITRK1, a candidate gene for Gilles de la Tourette syndrome.
17712845 2007 A large Italian family with Gilles de la Tourette syndrome: clinical study and analysis of the SLITRK1 gene.
17671968 2008 Association study between Gilles de la Tourette Syndrome and two genes in the Robo-Slit pathway located in the chromosome 11q24 linked/associated region.
17083340 2006 Examination of the SLITRK1 gene in Caucasian patients with Tourette syndrome.
17035247 2006 Overrepresentation of rare variants in a specific ethnic group may confuse interpretation of association analyses.
17003809 2006 SLITRK1 mutations in trichotillomania.
16936762 2006 Functional SLITRK1 var321, varCDfs and SLC6A4 G56A variants and susceptibility to obsessive-compulsive disorder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16323357 2005 SLITRK1 trouble in Tourette's syndrome.
16224024 2005 Sequence variants in SLITRK1 are associated with Tourette's syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14557068 2003 Human SLITRK family genes: genomic organization and expression profiling in normal brain and brain tumor tissue.
14550773 2003 Identification and characterization of Slitrk, a novel neuronal transmembrane protein family controlling neurite outgrowth.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.