Property Summary

NCBI Gene PubMed Count 39
PubMed Score 154.77
PubTator Score 31.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -5.100 3.1e-09
cutaneous lupus erythematosus -1.100 1.9e-03
psoriasis 1.200 1.6e-02
posterior fossa group A ependymoma -1.200 7.3e-11
glioblastoma -1.200 2.7e-09
sonic hedgehog group medulloblastoma -1.300 1.5e-06
Atopic dermatitis -1.500 1.7e-04
non-small cell lung carcinoma -1.600 6.1e-26
intraductal papillary-mucinous adenoma (... -1.500 6.4e-05
intraductal papillary-mucinous carcinoma... -1.500 1.3e-04
intraductal papillary-mucinous neoplasm ... -1.600 1.1e-03
colon cancer -1.600 6.2e-05
lung cancer -3.100 6.2e-06
breast carcinoma -1.800 3.8e-05
fibroadenoma -1.100 3.5e-02
lung adenocarcinoma -2.400 1.2e-08
adult high grade glioma -1.300 8.0e-05
pilocytic astrocytoma -1.100 1.8e-07
subependymal giant cell astrocytoma -1.291 1.6e-02
Breast cancer -1.200 4.6e-02
invasive ductal carcinoma -2.000 1.4e-03
lung carcinoma -1.500 6.2e-10
ductal carcinoma in situ -1.200 7.8e-03
ovarian cancer -1.500 6.4e-10

Gene RIF (24)

PMID Text
26542734 Overexpression of Slit3 induces its tumor suppressive effects in Breast cancer.
26045181 Results show that silencing of Slit3 promoted proliferation, migration and invasion of A549 cells and induced epithelial-mesenchymal transition suggesting that Slit3 functions as a tumor suppressor in lung carcinoma.
25051436 Estrogen-dependent expression of SLIT3 may play a key role in regulating nerve-vessel interactions within the complex microenvironment of endometriosis lesions.
24286238 SLIT3 is increased with labour, and both amnion and myometrial studies describe a pro-inflammatory effect of SLIT3 in these tissues.
24158112 High SLIT3 expression is associated with high-grade gliomas.
24090675 SLIT3-ROBO4 activation promotes vascular network formation in human engineered tissue and angiogenesis in vivo.
23720784 results implicate the involvement of miR-218-2 and its host gene SLIT3 in thyroid cancer cell invasion, migration, and proliferation
22614124 Slit3 treatment increased the in vivo homing efficiency of CD34 HSPCs to the BM in NOD/SCID mice, whereas Slit3-exposed HSPC migration in vitro was inhibited. Results support a role for Slit3 in human HSPC migration in vitro and homing in vivo.
21465248 three major members (Slit2/3 and Robo1) of Slit/Robo family are widely expressed in the human normal and malignant ovarian tissues; but Slit/Robo signaling may not play an important role in regulating human ovarian cancer cell proliferation and migration
21152026 SLIT3 duplication on 5q35.1 predisposes to major depressive disorder
21078908 The chemorepellent Slit3 promotes monocyte migration.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20298552 Slit3 inhibits Robo3-induced invasion of synovial fibroblasts in rheumatoid arthritis.
20163849 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19741192 functions to promote angiogenesis in coordinating organogenesis during embryonic development
19240061 Observational study of gene-disease association. (HuGE Navigator)
19228371 Observational study of gene-disease association. (HuGE Navigator)
18829537 Slits are negative regulators of Sdf1 and Cxcr4 in breast cancer cells.
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16840550 In fetal and embryonic stem cell cultures Slit-3 inhibited neurite outgrowth.
16162649 data suggest that Slit proteins play a key role in guiding dorsally projecting cranial motoneurons and in facilitating their neural tube exit
15231749 Observational study of genotype prevalence. (HuGE Navigator)
15231749 Many variants in SLIT3 tend to associate with schizophrenia susceptibility in the Chinese Han population.
12141424 Analysis of alternative splicing and conserved domains in human and mouse slit genes

AA Sequence

MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDR      1 - 70
NNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDL     71 - 140
SENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTL    141 - 210
RLHSNHLYCDCHLAWLSDWLRQRRTVGQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISC    211 - 280
PSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDA    281 - 350
FQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK    351 - 420
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED    421 - 490
YRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLR    491 - 560
KINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSS    561 - 630
VRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIP    631 - 700
IQDVAIQDFTCDGNEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRE    701 - 770
LSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE    771 - 840
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVD    841 - 910
INIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGF    911 - 980
SCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAK    981 - 1050
CIPLDKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQT   1051 - 1120
SPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDK   1121 - 1190
DNGILLYKGDNDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPK   1191 - 1260
SLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSP   1261 - 1330
GCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGD   1331 - 1400
LCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA   1401 - 1470
SKVPIMECRGGCGPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCLACS                    1471 - 1523
//

Text Mined References (42)

PMID Year Title
26542734 2015 Function of Slit/Robo signaling in breast cancer.
26045181 2015 Effects of Slit3 silencing on the invasive ability of lung carcinoma A549 cells.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25051436 2014 Estrogen receptor (ER) agonists differentially regulate neuroangiogenesis in peritoneal endometriosis via the repellent factor SLIT3.
24286238 2014 SLIT3 is increased in supracervical human foetal membranes and in labouring myometrium and regulates pro-inflammatory mediators.
24158112 2013 Experimental validation of 5 in-silico predicted glioma biomarkers.
24090675 2013 SLIT3-ROBO4 activation promotes vascular network formation in human engineered tissue and angiogenesis in vivo.
23720784 2013 Down-regulation of miR-218-2 and its host gene SLIT3 cooperate to promote invasion and progression of thyroid cancer.
22922792 2012 Fragments of SLIT3 inhibit cellular migration.
22614124 2012 Control of human hematopoietic stem/progenitor cell migration by the extracellular matrix protein Slit3.
21465248 2011 Expression and roles of Slit/Robo in human ovarian cancer.
21152026 2010 Duplication of the SLIT3 locus on 5q35.1 predisposes to major depressive disorder.
21078908 2010 The chemorepellent Slit3 promotes monocyte migration.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20298552 2010 Slit3 inhibits Robo3-induced invasion of synovial fibroblasts in rheumatoid arthritis.
20163849 2010 Polymorphisms involved in the miR-218-LAMB3 pathway and susceptibility of cervical cancer, a case-control study in Chinese women.
19741192 2009 Repulsive axon guidance molecule Slit3 is a novel angiogenic factor.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19228371 2009 Non-replication of an association of CTNNBL1 polymorphisms and obesity in a population of Central European ancestry.
18829537 2008 SLITs suppress tumor growth in vivo by silencing Sdf1/Cxcr4 within breast epithelium.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
18566128 2008 Novel regulated expression of the SLIT/ROBO pathway in the ovary: possible role during luteolysis in women.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16840550 2006 Axonal growth regulation of fetal and embryonic stem cell-derived dopaminergic neurons by Netrin-1 and Slits.
16162649 2005 Slit-mediated repulsion is a key regulator of motor axon pathfinding in the hindbrain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15231749 2004 Genetic structure adds power to detect schizophrenia susceptibility at SLIT3 in the Chinese Han population.
15207848 2004 Extracellular Ig domains 1 and 2 of Robo are important for ligand (Slit) binding.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.
12141424 2002 Conserved modularity and potential for alternate splicing in mouse and human Slit genes.
11754167 2002 Spatiotemporal expression patterns of slit and robo genes in the rat brain.
11748139 2001 Slit proteins are not dominant chemorepellents for olfactory tract and spinal motor axons.
11443047 2001 Dual trafficking of Slit3 to mitochondria and cell surface demonstrates novel localization for Slit protein.
10349621 1998 Distinct but overlapping expression patterns of two vertebrate slit homologs implies functional roles in CNS development and organogenesis.
9813312 1998 Cloning and expressions of three mammalian homologues of Drosophila slit suggest possible roles for Slit in the formation and maintenance of the nervous system.
9693030 1998 Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening.