Property Summary

NCBI Gene PubMed Count 5
PubMed Score 8.45
PubTator Score 4.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 1.1e-03
posterior fossa group B ependymoma 2.300 1.2e-08
glioblastoma 1.700 4.0e-04
atypical teratoid / rhabdoid tumor 1.900 1.1e-03
lung cancer -1.300 4.8e-03
cystic fibrosis 1.100 4.8e-03
pediatric high grade glioma 1.400 2.2e-04
pilocytic astrocytoma 1.300 1.4e-06
lung carcinoma -1.200 5.0e-15
ovarian cancer 1.200 2.0e-04

Gene RIF (1)

PMID Text
24768141 Ad-SLFN12 overexpression increased the ratio of the mature E-cadherin protein to its precursor protein

AA Sequence

MNISVDLETNYAELVLDVGRVTLGENSRKKMKDCKLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSY      1 - 70
TKDGIGLDLENSFSNILLFVPEYLDFMQNGNYFLIFVKSWSLNTSGLRITTLSSNLYKRDITSAKVMNAT     71 - 140
AALEFLKDMKKTRGRLYLRPELLAKRPCVDIQEENNMKALAGVFFDRTELDRKEKLTFTESTHVEIKNFS    141 - 210
TEKLLQRIKEILPQYVSAFANTDGGYLFIGLNEDKEIIGFKAEMSDLDDLEREIEKSIRKMPVHHFCMEK    211 - 280
KKINYSCKFLGVYDKGSLCGYVCALRVERFCCAVFAKEPDSWHVKDNRVMQLTRKEWIQFMVEAEPKFSS    281 - 350
SYEEVISQINTSLPAPHSWPLLEWQRQRHHCPGLSGRITYTPENLCRKLFLQHEGLKQLICEEMDSVRKG    351 - 420
SLIFSRSWSVDLGLQENHKVLCDALLISQDSPPVLYTFHMVQDEEFKGYSTQTALTLKQKLAKIGGYTKK    421 - 490
VCVMTKIFYLSPEGMTSCQYDLRSQVIYPESYYFTRRKYLLKALFKALKRLKSLRDQFSFAENLYQIIGI    491 - 560
DCFQKNDKKMFKSCRRLT                                                        561 - 578
//

Text Mined References (5)

PMID Year Title
24768141 2014 Schlafen 12 expression modulates prostate cancer cell differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9846487 1998 Schlafen, a new family of growth regulatory genes that affect thymocyte development.