Property Summary

NCBI Gene PubMed Count 23
PubMed Score 22.97
PubTator Score 17.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis 1.268 1.3e-04
malignant mesothelioma -5.200 6.6e-08
psoriasis -1.500 2.2e-08
osteosarcoma -1.712 1.0e-03
group 4 medulloblastoma -2.100 3.1e-05
cystic fibrosis 1.733 2.4e-05
glioblastoma -1.200 2.5e-02
medulloblastoma, large-cell -2.200 1.4e-06
intraductal papillary-mucinous adenoma (... -1.600 8.5e-04
intraductal papillary-mucinous neoplasm ... 1.500 3.7e-02
lung cancer 2.300 1.0e-05
adult high grade glioma -1.400 4.8e-03
Pick disease 1.100 1.8e-04
Breast cancer -1.100 4.4e-04
ovarian cancer -2.100 1.2e-07
pituitary cancer -1.100 9.1e-04

Gene RIF (10)

PMID Text
26349991 our results revealed altered OATP3A1 and OATP4A1 mRNA levels and novel mechanisms that might be involved in their regulation in colorectal cancer
24945726 SLCO3A1, a novel Crohn's disease-associated gene, mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation.
22377092 Single nucleotide polymorhpisms of SLCO3A1 were associated with nicotine dependence.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
21278488 tissue-specific localization of OATP2B1, OATP3A1 and OATP5A1 has been analyzed in normal mammary tissue and corresponding breast cancer tissues.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19330903 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18521091 Genome-wide association study of gene-disease association. (HuGE Navigator)
16971491 Further evidence is provided for the involvement of OATPs in oligopeptide transport. OATP3A1 variants might be involved in the regulation of extracellular vasopressin concentration in human brain.
14631946 OATP-D plays an important role in translocating prostaglandins in specialized tissues and cells.

AA Sequence

MQGKKPGGSSGGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLVSECALMLAQGTVGAYLVSVLTTLERR      1 - 70
FNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEI     71 - 140
RWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKD    141 - 210
SSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSL    211 - 280
LMFGFPQSLPPHSEPAMESEQAMLSEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPV    281 - 350
FTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGA    351 - 420
IRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVPYGNSTAPGSALDPYSPCNNNCECQTDSFTPVCGADG    421 - 490
ITYLSACFAGCNSTNLTGCACLTTVPAENATVVPGKCPSPGCQEAFLTFLCVMCICSLIGAMAQTPSVII    491 - 560
LIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVSIA    561 - 630
IALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNLGRDPVPANQTHRTKFIYNLEDH    631 - 700
EWCENMESVL                                                                701 - 710
//

Text Mined References (25)

PMID Year Title
26349991 2015 Effect of DNA methylation profile on OATP3A1 and OATP4A1 transcript levels in colorectal cancer.
24945726 2014 SLCO3A1, A novel crohn's disease-associated gene, regulates nf-?B activity and associates with intestinal perforation.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22377092 2012 ANAPC1 and SLCO3A1 are associated with nicotine dependence: meta-analysis of genome-wide association studies.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
21278488 2011 Expression and localization of the uptake transporters OATP2B1, OATP3A1 and OATP5A1 in non-malignant and malignant breast tissue.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19330903 2009 Gene by smoking interaction in hypertension: identification of a major quantitative trait locus on chromosome 15q for systolic blood pressure in Mexican-Americans.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18521091 2009 Whole genome association study identifies polymorphisms associated with QT prolongation during iloperidone treatment of schizophrenia.
16971491 2007 Characterization of two splice variants of human organic anion transporting polypeptide 3A1 isolated from human brain.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14631946 2003 Molecular characterization of human and rat organic anion transporter OATP-D.
14579113 2004 Organic anion transporting polypeptides of the OATP/ SLC21 family: phylogenetic classification as OATP/ SLCO superfamily, new nomenclature and molecular/functional properties.
12542534 2003 Active influx transport is mediated by members of the organic anion transporting polypeptide family in human epidermal keratinocytes.
12495658 2003 Semi quantitative expression analysis of MDR3, FIC1, BSEP, OATP-A, OATP-C,OATP-D, OATP-E and NTCP gene transcripts in 1st and 3rd trimester human placenta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10873595 2000 Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family.