Property Summary

Ligand Count 3
NCBI Gene PubMed Count 52
PubMed Score 121.54
PubTator Score 106.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.650 1.7e-04
astrocytic glioma 1.200 2.5e-02
cutaneous lupus erythematosus 1.100 6.2e-03
gastric carcinoma 1.200 4.6e-02
glioblastoma 1.500 1.9e-03
interstitial cystitis 1.100 1.2e-02
intraductal papillary-mucinous adenoma (... -1.200 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-02
invasive ductal carcinoma 1.361 7.5e-04
lung adenocarcinoma -1.200 6.6e-05
lung cancer -2.000 1.4e-04
lung carcinoma -2.300 1.9e-26
medulloblastoma, large-cell -1.500 5.7e-06
non-small cell lung cancer -1.528 1.5e-12
osteosarcoma 1.374 8.0e-03
ovarian cancer 1.200 2.0e-03
pancreatic ductal adenocarcinoma liver m... -1.510 4.3e-03
subependymal giant cell astrocytoma 1.386 2.2e-02

Gene RIF (48)

AA Sequence

MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLK      1 - 70
SSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGYGAILVALAGLLMTLPHFISE     71 - 140
PYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFG    141 - 210
ISYIDDFAHNSNSPLYLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGF    211 - 280
LIAAGAVALAAIPYFFFPKEMPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPN    281 - 350
LTVIQFIKVFPRVLLQTLRHPIFLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPS    351 - 420
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCM    421 - 490
EACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHL    491 - 560
VVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVGIQFMFLRILAWMPSPVIHGSAIDTTCVHWA    561 - 630
LSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGP    631 - 700
GKKPEDSRV                                                                 701 - 709
//

Text Mined References (57)

PMID Year Title