Property Summary

NCBI Gene PubMed Count 25
PubMed Score 51.44
PubTator Score 26.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -3.800 2.2e-08
glioblastoma -1.600 3.8e-02
group 3 medulloblastoma -3.400 8.5e-04
medulloblastoma, large-cell -4.400 5.5e-06
pediatric high grade glioma -1.500 4.4e-02
primitive neuroectodermal tumor -3.000 2.3e-04

Gene RIF (12)

AA Sequence

MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLCALSFVYFAKALAEGYLKSTITQI      1 - 70
ERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCVIMGVGTLLIAMPQFFMEQYKYER     71 - 140
YSPSSNSTLSISPCLLESSSQLPVSVMEKSKSKISNECEVDTSSSMWIYVFLGNLLRGIGETPIQPLGIA    141 - 210
YLDDFASEDNAAFYIGCVQTVAIIGPIFGFLLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLI    211 - 280
AGIISLLAAVPFWYLPKSLPRSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLF    281 - 350
GNPVYFLYLCTSTVQFNSLFGMVTYKPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIVMKKFRIS    351 - 420
VCGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGTKPVSYHERALFSDCNSRCKCSETKWEPM    421 - 490
CGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGRCQKDNGCPQMFLYFLVISVI    491 - 560
TSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLAIRVLAGIPAPVYFGVLIDTSCLKWGFKRCGSRGSC    561 - 630
RLYDSNVFRHIYLGLTVILGTVSILLSIAVLFILKKNYVSKHRSFITKRERTMVSTRFQKENYTTSDHLL    631 - 700
QPNYWPGKETQL                                                              701 - 712
//

Text Mined References (28)

PMID Year Title