Property Summary

Ligand Count 2
NCBI Gene PubMed Count 50
PubMed Score 331.57
PubTator Score 213.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
progressive supranuclear palsy -2.200 1.1e-02
atypical teratoid/rhabdoid tumor -1.200 4.1e-03
ependymoma -1.300 4.6e-04
glioblastoma multiforme -1.500 3.9e-11
lung adenocarcinoma -1.600 2.3e-15
lung carcinoma -1.200 2.9e-06
medulloblastoma -1.400 6.2e-04
ovarian cancer -1.200 1.4e-06
Pick disease -1.400 1.5e-02
psoriasis -1.100 1.6e-08
subependymal giant cell astrocytoma -1.536 1.2e-02

Gene RIF (39)

AA Sequence

MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNL      1 - 70
LLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVSVSGNLSSNSFLCMENGTQIL     71 - 140
RPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGISYIEDFAKFENSPLYIGLVETGAIIGPLIG    141 - 210
LLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNAD    211 - 280
IIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGIS    281 - 350
SSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT    351 - 420
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTS    421 - 490
GNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAG    491 - 560
IPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRKCHLPG    561 - 630
ENASSGTELIETKVKGKENECKDIYQKSTVLKDDELKTKL                                  631 - 670
//

Text Mined References (52)

PMID Year Title