Property Summary

NCBI Gene PubMed Count 47
PubMed Score 308.21
PubTator Score 213.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
progressive supranuclear palsy -2.200 1.1e-02
glioblastoma multiforme -1.500 3.9e-11
posterior fossa group A ependymoma -1.400 2.4e-04
medulloblastoma -1.400 6.2e-04
lung adenocarcinoma -1.600 2.3e-15
atypical teratoid/rhabdoid tumor -1.200 4.1e-03
subependymal giant cell astrocytoma -1.562 3.9e-03
lung carcinoma -1.200 2.9e-06
Pick disease -1.400 1.5e-02
ovarian cancer -1.200 1.4e-06
psoriasis -1.100 1.6e-08

Protein-protein Interaction (1)

Gene RIF (36)

PMID Text
25924632 Genetic polymorphisms and function of the OATP1A2 and its clinical relevance in drug disposition
25560245 Report OATP1A2 expression in human retinal pigmented epithelial cells and suggest role in cellular uptake of all-trans retinol.
25387129 analysis of how the transmembrane domain 6 of the human organic anion transporting polypeptide 1A2 (OATP1A2) influences transporter substrate binding, protein trafficking, and quality control
24825069 human OATP1B1, OATP1B3 and OATP1A2 can transport docetaxel in vivo.
24728453 PDZK1 and NHERF1 regulate the transport function of OATP1A2 by modulating protein internalization via a clathrin-dependent pathway and by enhancing protein stability.
24671357 Combined high OATP1A2/high OCT6 may be a potential predictor of response to anthracycline/taxane-based chemotherapy in breast cancer
23918469 Five novel single nucleotide polymorphisms (SNIP)S in the coding exons of SLCO1A2 gene transporter have been identified.
23243220 Human OATP1A/1B transporters play an important role in plasma and tissue distribution of the structurally diverse chemotherapeutics methotrexate and paclitaxel
22864060 results suggest that enhanced OATP1A2 expression is associated with adaptive cell growth of prostate cancer cells under androgen-depleted conditions
22509823 Hydrophilic anti-migraine triptans are substrates for OATP1A2, a transporter expressed at human blood-brain barrier.
22474172 SLCO1A2 promoter variant 1 was strongly induced by vitamin D receptor.
22203093 The expression of OATP1A2 and OATP1B3 in placenta decreased in, and may be involved in the pathophysiology of, intrahepatic cholestasis of pregnancy. OATP1A2 was localized to the vasculo-syncytial membrane and apical surface of syncytiotrophoblasts.
22124880 Data suggest that inhibition of OATP1A2 in intestinal mucosa at least partially explains effects of grapefruit juice (or grapefruit juice components such as the flavonoid naringin) on pharmacokinetics of aliskiren, an antihypertensive agent.
21849517 Digoxin inhibited the uptake of probe substrates of OATP1B1 (IC(50) of 47 muM), OATP1B3 (IC(50) > 8.1 muM), and OATP2B1 (IC(50) > 300 muM), but not OATP1A2 in transfected cell lines.
21633340 SLCO1A2 polymorphisms significantly affect imatinib pharmacokinetics.
21508937 Although imatinib is indicated as a substrate for OATP1A2, this transporter by itself is unlikely to contribute substantially to the absorption profiles of imatinib in humans.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
21133891 protein kinase C(PKC) regulates the transport function of OATP1A2 by modulating protein internalization; this effect of PKC is mediated in part by clathrine-dependent pathways
20837016 By using the presence of bilirubin as a phenotype, variants rs6742078 (UGT1A1; P = .003), rs4149056 (SLCO1B1; P = .003), and rs4149000 (SLCO1A2; P = .015) were associated with gallstone composition
20837016 Observational study of gene-disease association. (HuGE Navigator)
20635135 data suggest that among the many known transporters common variations of PXR, SLCO1A2, SLCO1B1, SLCO1B3, and SLCO2B1 do not contribute to breast carcinogenesis
20635135 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20560925 Is present in high frequencies in the finnish population
20560925 Observational study of genotype prevalence. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20051929 Antiretroviral protease inhibitors, but not non-nucleoside reverse transcriptase inhibitors, are substrates for OATP1A2, OATP1B1 and OATP1B3.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890249 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19010908 the interplay between a xenobiotic nuclear receptor PXR and OATP1A2 that could contribute to the pathogenesis of breast cancer.
18695635 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18466105 Review summarizes current knowledge on the functional and phenotypic consequences of genetic variation in intestinally, hepatically and renally expressed members of the organic anion-transporting polypeptide (OATP) family.
15832500 a potentially important role for OATP-A in the absorption and disposition of saquinovir in vivo.
15632119 Observational study of genotype prevalence. (HuGE Navigator)
15632119 SLCO1A2 polymorphisms may be an important yet unrecognized contributor to inter-individual variability in drug disposition and central nervous system entry of substrate drugs.

AA Sequence

MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNL      1 - 70
LLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVSVSGNLSSNSFLCMENGTQIL     71 - 140
RPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGISYIEDFAKFENSPLYIGLVETGAIIGPLIG    141 - 210
LLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNAD    211 - 280
IIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGIS    281 - 350
SSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT    351 - 420
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTS    421 - 490
GNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAG    491 - 560
IPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRKCHLPG    561 - 630
ENASSGTELIETKVKGKENECKDIYQKSTVLKDDELKTKL                                  631 - 670
//

Text Mined References (49)

PMID Year Title
25924632 2015 Genetic polymorphisms and function of the organic anion-transporting polypeptide 1A2 and its clinical relevance in drug disposition.
25560245 2015 Human organic anion transporting polypeptide 1A2 (OATP1A2) mediates cellular uptake of all-trans-retinol in human retinal pigmented epithelial cells.
25387129 2015 Putative transmembrane domain 6 of the human organic anion transporting polypeptide 1A2 (OATP1A2) influences transporter substrate binding, protein trafficking, and quality control.
24825069 2015 Human OATP1B1, OATP1B3 and OATP1A2 can mediate the in vivo uptake and clearance of docetaxel.
24728453 2014 PDZK1 and NHERF1 regulate the function of human organic anion transporting polypeptide 1A2 (OATP1A2) by modulating its subcellular trafficking and stability.
24671357 2014 Expression of organic anion-transporting polypeptide 1A2 and organic cation transporter 6 as a predictor of pathologic response to neoadjuvant chemotherapy in triple negative breast cancer.
23918469 2013 Functional analysis of novel polymorphisms in the human SLCO1A2 gene that encodes the transporter OATP1A2.
23243220 2013 Influence of human OATP1B1, OATP1B3, and OATP1A2 on the pharmacokinetics of methotrexate and paclitaxel in humanized transgenic mice.
22864060 2012 Enhanced expression of organic anion transporting polypeptides (OATPs) in androgen receptor-positive prostate cancer cells: possible role of OATP1A2 in adaptive cell growth under androgen-depleted conditions.
22509823 2012 Hydrophilic anti-migraine triptans are substrates for OATP1A2, a transporter expressed at human blood-brain barrier.
22474172 2012 The SLCO1A2 gene, encoding human organic anion-transporting polypeptide 1A2, is transactivated by the vitamin D receptor.
22203093 2012 Alteration in placental expression of bile acids transporters OATP1A2, OATP1B1, OATP1B3 in intrahepatic cholestasis of pregnancy.
22124880 2012 Intestinal OATP1A2 inhibition as a potential mechanism for the effect of grapefruit juice on aliskiren pharmacokinetics in healthy subjects.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21849517 2011 Digoxin is not a substrate for organic anion-transporting polypeptide transporters OATP1A2, OATP1B1, OATP1B3, and OATP2B1 but is a substrate for a sodium-dependent transporter expressed in HEK293 cells.
21685912 2011 Identification of common variants influencing risk of the tauopathy progressive supranuclear palsy.
21633340 2011 Pharmacokinetic impact of SLCO1A2 polymorphisms on imatinib disposition in patients with chronic myeloid leukemia.
21508937 2011 Environmental and genetic factors affecting transport of imatinib by OATP1A2.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
21133891 2011 Protein kinase C regulates the internalization and function of the human organic anion transporting polypeptide 1A2.
20837016 2010 Loci from a genome-wide analysis of bilirubin levels are associated with gallstone risk and composition.
20635135 2011 Polymorphisms of the nuclear receptor pregnane X receptor and organic anion transporter polypeptides 1A2, 1B1, 1B3, and 2B1 are not associated with breast cancer risk.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20560925 2011 Frequencies of single-nucleotide polymorphisms of SLCO1A2, SLCO1B3 and SLCO2B1 genes in a Finnish population.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20051929 2010 HIV protease inhibitors are substrates for OATP1A2, OATP1B1 and OATP1B3 and lopinavir plasma concentrations are influenced by SLCO1B1 polymorphisms.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19901119 2009 Germline genetic variation in an organic anion transporter polypeptide associated with methotrexate pharmacokinetics and clinical effects.
19890249 2010 The role of organic anion-transporting polypeptides and their common genetic variants in mycophenolic acid pharmacokinetics.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
19010908 2008 Interplay between the nuclear receptor pregnane X receptor and the uptake transporter organic anion transporter polypeptide 1A2 selectively enhances estrogen effects in breast cancer.
18695635 2008 Influence of drug transporters and UGT polymorphisms on pharmacokinetics of phenolic glucuronide metabolite of mycophenolic acid in Japanese renal transplant recipients.
18466105 2008 Pharmacogenetics of OATP (SLC21/SLCO), OAT and OCT (SLC22) and PEPT (SLC15) transporters in the intestine, liver and kidney.
17301733 2007 Naringin is a major and selective clinical inhibitor of organic anion-transporting polypeptide 1A2 (OATP1A2) in grapefruit juice.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15832500 2004 Human organic anion-transporting polypeptide OATP-A (SLC21A3) acts in concert with P-glycoprotein and multidrug resistance protein 2 in the vectorial transport of Saquinavir in Hep G2 cells.
15632119 2005 Polymorphisms in human organic anion-transporting polypeptide 1A2 (OATP1A2): implications for altered drug disposition and central nervous system drug entry.
14579113 2004 Organic anion transporting polypeptides of the OATP/ SLC21 family: phylogenetic classification as OATP/ SLCO superfamily, new nomenclature and molecular/functional properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11238933 2001 Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes.
10873595 2000 Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family.
10779507 2000 Localization and genomic organization of a new hepatocellular organic anion transporting polypeptide.
9539145 1998 Dehydroepiandrosterone sulfate (DHEAS): identification of a carrier protein in human liver and brain.
9398014 1997 Substrate specificity of sinusoidal bile acid and organic anion uptake systems in rat and human liver.
9328325 1997 Identification and functional characterization of the promoter region of the human organic anion transporting polypeptide gene.
9007731 1996 Assignment of the human organic anion transporting polypeptide (OATP) gene to chromosome 12p12 by fluorescence in situ hybridization.
7557095 1995 Molecular and functional characterization of an organic anion transporting polypeptide cloned from human liver.