Property Summary

NCBI Gene PubMed Count 3
PubMed Score 101.67
PubTator Score 15.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 8.8e-10
Disease Target Count Z-score Confidence
Hereditary spherocytosis type 4 18 3.663 1.8
Cryptococcosis 18 3.148 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.880 8.8e-10

Gene RIF (3)

AA Sequence

MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAQEETKTVLSDTEEIKPQTKKETYISCPLRGVLNVIITN      1 - 70
GVILFVIWCMTWSILGSEALPGGNLFGLFIIFYSAIIGGKILQLIRIPLVPPLPPLLGMLLAGFTIRNVP     71 - 140
FINEHVHVPNTWSSILRSIALTIILIRAGLGLDPQALRHLKVVCFRLAVGPCLMEASAAAVFSHFIMKFP    141 - 210
WQWAFLLGFVLGAVSPAVVVPYMMVLQENGYGVEEGIPTLLMAASSMDDILAITGFNTCLSIVFSSGGIL    211 - 280
NNAIASIRNVCISLLAGIVLGFFVRYFPSEDQKKLTLKRGFLVLTMCVSAVLGSQRIGLHGSGGLCTLVL    281 - 350
SFIAGTKWSQEKMKVQKIITTVWDIFQPLLFGLVGAEVSVSSLESNIVGISVATLSLALCVRILTTYLLM    351 - 420
CFAGFSFKEKIFIALAWMPKATVQAVLGPLALETARVSAPHLEPYAKDVMTVAFLAILITAPNGALLMGI    421 - 490
LGPKMLTRHYDPSKIKLQLSTLEHH                                                 491 - 515
//

Text Mined References (5)

PMID Year Title