Property Summary

NCBI Gene PubMed Count 28
PubMed Score 16.92
PubTator Score 18.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
osteosarcoma -1.425 1.9e-03
group 3 medulloblastoma -1.600 1.9e-04
atypical teratoid/rhabdoid tumor -1.300 1.3e-05
glioblastoma 1.200 3.2e-03
medulloblastoma, large-cell -1.700 4.7e-05
tuberculosis 2.100 1.6e-09
intraductal papillary-mucinous carcinoma... -1.100 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.300 9.6e-03
breast carcinoma -1.200 3.3e-03
fibroadenoma -1.500 1.5e-02
pilocytic astrocytoma 1.200 4.0e-06
lung adenocarcinoma -1.300 1.5e-06
mucosa-associated lymphoid tissue lympho... 2.076 1.3e-02
ductal carcinoma in situ -1.100 3.2e-03
invasive ductal carcinoma -1.200 3.5e-03
acute myeloid leukemia -1.300 4.7e-02
ovarian cancer -1.700 6.1e-14

Gene RIF (17)

PMID Text
25915159 Taken together, our findings demonstrate that NHE9 can be an effective predictor of chemoradiotherapy response in esophageal squamous cell carcinoma
25914168 SLC9A9 appears to influence the differentiation of T cells to a proinflammatory fate and may have a broader role in multiple sclerosis disease activity. There is an association between rs9828519(G) and nonresponse to IFNbeta treatment.
25835977 the expression of SLC9A9 can be a prognostic predictor for ESCC.
24874739 EIPA, a potent and specific inhibitor of Na+/H+ exchanger activity, significantly inhibits the Nef internalization into M2-macrophages, indicating that Nef is imported by Na+/H+ exchanger (solute carrier family 9, subfamily A)
24065030 Loss-of-function mutations in NHE9 may contribute to autistic phenotype by modulating synaptic membrane protein expression and neurotransmitter clearance.
23508127 find interesting gene expression changes in endosomal NHE6 and NHE9 in postmortem autism brains.
21908519 33 directly measured and 13 derived glycosylation traits in 3533 individuals were identified and three novel gene association (MGAT5, B3GAT1 and SLC9A9) were identified using an additional European cohort.
21555518 SLC9A9 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21171650 This review defines NHE6-9 as organellar NHEs that are fairly dynamic, implying that they are subjected to intracellular trafficking and thus they continuously shuttle between organelles and the plasma membrane.
20732626 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20032819 results suggest that SLC9A9 may be related to hyperactive-impulsive symptoms in AD/HD and the disruption of SLC9A9 may be responsible for the behavioral phenotype observed in the inversion family
20032819 Observational study of gene-disease association. (HuGE Navigator)
19268276 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18937294 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18821565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGLIMGLILRYAT      1 - 70
APTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAILEKMTFDPEIFFNVLLP     71 - 140
PIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGLIMYGFVKAMIHAGQLKNGDFHFTDCLFFGSL    141 - 210
MSATDPVTVLAIFHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDAAAFFQSVGNFLG    211 - 280
IFAGSFAMGSAYAIITALLTKFTKLCEFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTY    281 - 350
NNLSSDSKIRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLN    351 - 420
LGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIR    421 - 490
VGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPIS    491 - 560
RLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGG    561 - 630
YELKLEQTLGQSQLN                                                           631 - 645
//

Text Mined References (34)

PMID Year Title
25915159 2015 NHE9 induces chemoradiotherapy resistance in esophageal squamous cell carcinoma by upregulating the Src/Akt/?-catenin pathway and Bcl-2 expression.
25914168 2015 A pharmacogenetic study implicates SLC9a9 in multiple sclerosis disease activity.
25835977 2015 Prognostic significance of SLC9A9 in patients with resectable esophageal squamous cell carcinoma.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24065030 2013 Functional evaluation of autism-associated mutations in NHE9.
23508127 2014 Genes for endosomal NHE6 and NHE9 are misregulated in autism brains.
23374588 2013 Pharmacogenomics in Alzheimer's disease: a genome-wide association study of response to cholinesterase inhibitors.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
21908519 2011 Polymorphisms in B3GAT1, SLC9A9 and MGAT5 are associated with variation within the human plasma N-glycome of 3533 European adults.
21858920 2011 SLC9A9 mutations, gene expression, and protein-protein interactions in rat models of attention-deficit/hyperactivity disorder.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21171650 2011 Organellar Na+/H+ exchangers: novel players in organelle pH regulation and their emerging functions.
20732626 2010 Family-based genome-wide association scan of attention-deficit/hyperactivity disorder.
20708005 2010 Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20032819 2010 Genetic variants in SLC9A9 are associated with measures of attention-deficit/hyperactivity disorder symptoms in families.
19268276 2009 Genome-wide association study of smoking initiation and current smoking.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18937294 2008 Genome-wide association scan of the time to onset of attention deficit hyperactivity disorder.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
18621663 2008 Identifying autism loci and genes by tracing recent shared ancestry.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15522866 2005 Four Na+/H+ exchanger isoforms are distributed to Golgi and post-Golgi compartments and are involved in organelle pH regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14569117 2003 Disruption of a novel member of a sodium/hydrogen exchanger family and DOCK3 is associated with an attention deficit hyperactivity disorder-like phenotype.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.