Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.33
PubTator Score 10.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -1.700 5.1e-05
astrocytic glioma -1.300 4.4e-02
osteosarcoma -1.143 5.2e-05
ependymoma -1.400 1.6e-06
sonic hedgehog group medulloblastoma -1.600 9.6e-05
atypical teratoid / rhabdoid tumor -1.600 1.6e-04
glioblastoma 1.400 1.5e-03
medulloblastoma, large-cell -2.100 6.1e-05
primitive neuroectodermal tumor -1.100 2.0e-02
tuberculosis and treatment for 6 months 1.200 5.2e-05
intraductal papillary-mucinous adenoma (... 1.300 4.0e-03
Hydrolethalus syndrome 1.407 4.8e-02
active Crohn's disease 2.739 1.9e-03
active ulcerative colitis 2.385 1.9e-03
adult high grade glioma -1.200 2.5e-04
pilocytic astrocytoma 1.600 1.2e-04
aldosterone-producing adenoma -1.568 9.3e-03
subependymal giant cell astrocytoma -2.055 2.8e-02
nasopharyngeal carcinoma 1.400 3.3e-04
Alzheimer's disease -1.100 3.5e-02
Pick disease -1.600 1.1e-04
Breast cancer -1.200 1.8e-07
ductal carcinoma in situ 1.600 1.6e-02

Gene RIF (7)

PMID Text
24874739 EIPA, a potent and specific inhibitor of Na+/H+ exchanger activity, significantly inhibits the Nef internalization into M2-macrophages, indicating that Nef is imported by Na+/H+ exchanger (solute carrier family 9, subfamily A)
24767989 NHE7 mediates an acidification of intracellular vesicles that is additive to that of V-ATPases and that accelerates endocytosis.
22076128 these results suggest that NHE7 enhances tumor progression.
21171650 This review defines NHE6-9 as organellar NHEs that are fairly dynamic, implying that they are subjected to intracellular trafficking and thus they continuously shuttle between organelles and the plasma membrane.
20364249 The results suggest that two membrane proximal regions (residues 533-559 and 563-568) play an important role in targeting NHE7 to the TGN
18654930 Among the NHE7-binding proteins identified, CD44, a cell surface glycoprotein receptor for hyaluronate and other ligands, showed regulated interaction with NHE7.
15840657 Secretory carrier membrane proteins participate in the shuttling of NHE7 between recycling vesicles and the TGN

AA Sequence

MEPGDAARPGSGRATGAPPPRLLLLPLLLGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQD      1 - 70
SVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGTPATSGRDKSLSCTQEDRAFS     71 - 140
TLLVNVSGKFFEYTLKGEISPGKINSVEQNDMLRKVTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGS    141 - 210
ILAYAFLGTAVSCFIIGNLMYGVVKLMKIMGQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDL    211 - 280
YALLFGESVLNDAVAIVLSSSIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVNANVTKF    281 - 350
TKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRTKQLFEVLHFLA    351 - 420
ENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNFQHMMMFSGLRG    421 - 490
AMAFALAIRDTASYARQMMFTTTLLIVFFTVWIIGGGTTPMLSWLNIRVGVEEPSEEDQNEHHWQYFRVG    491 - 560
VDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRLWYSFDHNYLKPILTHSGPPLTTTLPAWCGL    561 - 630
LARCLTSPQVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGSSSSHTASTSLEGSRRTKSSSEEVLE    631 - 700
RDLGMGDQKVSSRGTRLVFPLEDNA                                                 701 - 725
//

Text Mined References (11)

PMID Year Title
24767989 2014 The intracellular Na(+)/H(+) exchanger NHE7 effects a Na(+)-coupled, but not K(+)-coupled proton-loading mechanism in endocytosis.
22076128 2012 Organellar (Na+, K+)/H+ exchanger NHE7 regulates cell adhesion, invasion and anchorage-independent growth of breast cancer MDA-MB-231 cells.
21171650 2011 Organellar Na+/H+ exchangers: novel players in organelle pH regulation and their emerging functions.
20364249 2010 A membrane-proximal region in the C-terminal tail of NHE7 is required for its distribution in the trans-Golgi network, distinct from NHE6 localization at endosomes.
18654930 2008 Identification and biochemical characterization of the SLC9A7 interactome.
15840657 2005 Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11944989 2002 An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders.
11279194 2001 Molecular cloning and characterization of a novel (Na+,K+)/H+ exchanger localized to the trans-Golgi network.