Property Summary

NCBI Gene PubMed Count 72
PubMed Score 75.27
PubTator Score 62.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Hypertension 396 0.0 0.0
Disease Target Count
Hypertensive disease 292
Disease Target Count P-value
malignant mesothelioma 3232 6.9e-08
osteosarcoma 7950 1.8e-05
psoriasis 6694 6.9e-03
Disease Target Count Z-score Confidence
cystic fibrosis 1696 3.325 1.7
Diarrhea 253 3.321 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 3.000 6.9e-08
osteosarcoma -1.813 1.8e-05
psoriasis -1.900 6.9e-03

 GO Process (1)

Gene RIF (30)

AA Sequence

MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHH      1 - 70
QVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDV     71 - 140
SGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHA    141 - 210
EVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGS    211 - 280
DKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF                 281 - 337
//

Text Mined References (79)

PMID Year Title