Property Summary

NCBI Gene PubMed Count 182
PubMed Score 647.10
PubTator Score 517.36

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (146)

PMID Text
27083547 Human NHE1 acts as an ERK2 membrane protein scaffold in vivo that is necessary for ERK2 activation via direct interactions, and loss of scaffolding by NHE1 leads to decreased ERK2 activation.
26821117 In human ovarian cancer cells the inducible nitric oxide synthase (iNOS) is overexpressed leading to increased formation of nitric oxide (NO). The NO promotes a glycolytic phenotype (Warburg effect) leading to H+ generation, which are removed via the sodium, proton (H+) exchanger isoform 1 (NHE1) reducing the intracellular content of this acid equivalent.
26775040 interaction of NHE1, NCX1 and CaM mediates the effects of IL6 on human hepatocellular carcinoma
26646587 Data show that both mineralcorticoid receptor (MR) and G-protein estrogen receptor (GPER) contribute to the proliferation and migration of breast and endothelial cancer cells by sodium-hydrogen exchanger 1 protein (NHE-1) upon aldosterone exposure.
26397063 the present study revealed that miR-27b is upregulated by HPV16 E7 to inhibit PPARg expression and promotes proliferation and invasion in cervical carcinoma cells.
25802333 the results support the anti-apoptotic role of HO-1 induced by NHE1 in the K562R cell line and IM-insensitive CML patients
25760855 Functional studies of N266H mutation in SLC9A1 gene showed a minor effect on the level of expression and no effect on targeting of the protein, however there was a complete absence of SLC9A1 activity.
25748234 Importantly, the specific NHE1 inhibitor cariporide reduced both three-dimensional growth and invasion independently of PDAC subtype and synergistically sensitized these behaviors to low doses of erlotinib.
25724898 CIAPIN1 over-expression decreases NHE1 expression and ERK1/2 phosphorylation.
25677682 This review focuses on the role of NHE1 and OPN in cardiac remodeling and emphasizes the signaling pathways implicating OPN in the NHE1-induced hypertrophic response.
25620102 The NHE-1 is a ubiquitously expressed cell membrane protein which regulates intracellular pH (pH(i)) and extracellular pH (pH(e)) homeostasis and cell volume.
25514463 Data suggest that Na/H exchanger isoform one (NHE1) is critical in triple-negative breast cancer metastasis.
25372487 PKC-delta activates p38/MAPK, responsible for the inhibition of MMP-2 and -9 secretion, PKC-epsilon activates a pathway made of ERK1/2, mTOR and S6K responsible for the inhibition of NHE1 activity and cell migration.
25350536 The findings are consistent with a role for R425 in both neutralizing a helix dipole and maintaining NHE1 structure and function.
25275700 These results suggest a novel tumor suppressor function of merlin in melanoma cells: the inhibition of the proto-oncogenic NHE1 activity, possibly including its downstream signaling pathways.
25241983 We demonstrate, for the first time, that 3 different pHi regulators responsible for acid extruding, i.e. NHE and NBC, and MCT, are functionally co-existed in cultured radial artery smooth muscle cells.
25205112 Mutation of SLC9A1 is associated with ataxia-deafness Lichtenstein-Knorr syndrome.
25190744 Concurrent speed endurance and resistance training increases skeletal muscle NHE1 activity.
25162926 The results demonstrate that the Ser771Pro human genetic mutation has significant and detrimental physiological effects on the activity of the NHE1 protein, SLC9A1.
25043809 CIAPIN1 targeted NHE1 to mediate differentiation of K562 cells via ERK1/2 pathway.
24891603 Talin has a role in regulating moesin-NHE-1 recruitment to invadopodia in breast cancer
24874739 EIPA, a potent and specific inhibitor of Na+/H+ exchanger activity, significantly inhibits the Nef internalization into M2-macrophages, indicating that Nef is imported by Na+/H+ exchanger (solute carrier family 9, subfamily A)
24840010 NHE1 transmembrane (TM) region VI from V240 to V245 is closely associated with TM region VII and, in agreement with nuclear magnetic resonance (NMR) structure of VI-VII segments, V242 and F260 are in close association.
24717311 NHE1 upregulation is an important cytoprotective mechanism in human glioma cells.
24594116 probucol via inhibition of NHE1 attenuates atherosclerosis lesion growth and promotes plaque stability
24434427 CD44 regulates the metastasis of breast cancer cells through regulating NHE1 expression, which could be used as a novel strategy for breast cancer therapy.
24378530 The regulation of NHE-1 activity mediated by PKC-beta activation involves NHE-1 phosphorylation, which implies that the phosphorylation of NHE-1 directly affects glutamate-induced neuronal cell death.
24337203 Protease activity suppression increases relative invadopodial NHE1 expression, while NHE1 inhibition increases acid-induced protease secretion.
24136992 modulation of NHE1 activity by various activators and inhibitors occurs through the direct binding of these molecules to the LID, which alters the association of the LID with the plasma membrane.
24088894 NHE1 and calmodulin associate in vivo through endothelin-dependent cytosolic signaling pathways.
23902689 NaV1.5 colocalises with NHE-1 and caveolin-1 at the sites of matrix remodelling in invadopodia.
23837875 Disruption of the DNM2-dependent retrograde trafficking of NHE1 contributes to cardiomyocyte apoptosis.
23678047 acute acidosis activates NHE1 in mammalian kidney cells
23677982 NHE1 appears to be the only significant regulator of intracellular pH in preimplantation mouse embryos.
23602949 Phosphorylation of S770/S771 changes the conformation of the NHE1 C-terminal regulatory region in a pH-dependent manner.
23429008 NHE1 mediated contributions to myocardial injury may be attenuated by pharmacological inhibition. [Review]
23429007 The molecular mechanisms underlying NHE1 regulation. [Review]
23393197 Studies indicate that the activity of Na+/H+ Exchanger (NHE1) is regulated through the phosphorylation of key amino acids in the cytosolic domain as well as by its interaction with other intracellular proteins and lipids.
23331996 NHE1 is a new ATP-binding transporter that belongs to a major facilitator superfamily.
23303189 novel role of STCH in the regulation of pHi through site-specific interactions with NBCe1-B and NHE1 and subsequent modulation of membrane transporter expression.
23224899 NHE-1 is important for microglial (macrophage) activation and participates in the inflammatory response under pathological conditions including cerebral ischemia and traumatic brain injury.
23220151 Functional insights inferred from NHE1 structure models and analysis. [Review]
23184727 Report that NHE1 generates measurable pH nanodomains right at focal adhesions in melanoma cells.
22984264 Loss of both N-myristoylation and calcium binding of CHP3 decreases cell surface stability of NHE1.
22922957 Extracellular acidosis induces Ca(2+) oscillation via NHE1, leading to Ca(2+)/CaMKII-dependent CREB activation in human central nervous system pericytes.
22772156 results suggest that EL4 makes an extension upward from TM VII to make up part of the mouth of the NHE1 protein and is involved in cation selectivity or coordination
22718548 NHE-1 on 1p is silenced in oligodendrogliomas secondary to IDH-associated hypermethylation and 1p allelic loss.
22688515 NHE1 directly binds to calcineurin A and activates downstream NFAT signaling, leading to cardiomyocyte hypertrophy
22494070 NHE1 plays a critical role in the hypoxia-induced differentiation of K562 cells by regulating C/EBPa gene expression via activation of p38 MAPK signalling pathway.
22301060 Increased apical Na/H exchanger activity correlates with increased apical NHE1 expression in mutant cells, and increased apical localization in collecting ducts of kidney sections from transgenic polycystic kidney disease mice compared with control mice.
22270364 a novel function for NHE1 and NCX1 in membrane blebbing and permeability, and establish a link between membrane blebbing and integrin signaling.
22216126 Inhibition or shRNA-based depletion of the Na(+)/H(+) exchanger NHE-1, along with intracellular pH monitoring by live-cell imaging, revealed that invadopodia formation is associated with alterations in cellular pH homeostasis
22138972 results indicate that NHE1 is necessary for IGF-II-induced proliferation response of human gastric myofibroblasts
22120673 Data show that DeltaNErbB2 expression elicited Na(+), HCO(3)(-) cotransporter NBCn1 upregulation, Ser(703)-phosphorylation of Na(+)/H(+) exchanger NHE1.
21997166 NHE1 mediates HeLa cell metastasis via regulating the expression and localization of MT1-MMP and provides a theoretical basis for the development of novel therapeutic strategies targeting cervical cancer.
21931166 molecular mechanisms of the phosphorylation-dependent regulation of NHE1
21867601 Expression of NHE1 is up-regulated during apoptosis of HL-60 cells. Expression was not up-regulated in K562 cells.
21729545 inhibition of NHE1 activity can promote hypoxia-induced K562 cell differentiation
21669197 The NHE1 mediates MDA-MB-231 cells invasion partly through regulating MT1-MMP in ERK1/2 and p38 MAPK signaling pathways dependent manner.
21454803 Silencing the NHE1 gene significantly inhibited the hypoxia-induced proliferation, hypertrophy, and migration of human pulmonary artery smooth muscle cells via repression of the nuclear transcription factor E2F1.
21425832 That normal NHE1 function depends on a protein recognition element within the ID region that may be linked to NHE1 trafficking via an acidic ER export motif.
21413028 In mineralizing osteoblasts, slightly basic basal intracellular pH is maintained, and external acid load is dissipated, by high-capacity Na(+) /H(+) exchange via NHE1 and NHE6.
21349616 This review of role of NHE1 in pathogenesis of lactic acidosis causing kidney dysfunction focuses on the benefits of NHE1 transporter inhibition.
21345796 B-Raf associates with and stimulates NHE1 activity and that B-Raf(V600E) also increases NHE1 activity that raises intracellular pH.
21261728 NHE1 was overexpressed in hepatocellular carcinoma (HCC) and that inhibition of NHE1 could be a potential therapeutic target for HCC.
21221801 These findings suggest that NHE-1 in ulcerative colitis is regulated by NFkB induced through TLR-4 and MyD88 signaling mechanism.
21185840 NHE1 might participate in HIF-1-induced angiogenesis due, at least in part, to the alteration of calpain activity.
21170089 Na(V)1.5 and NHE1 are functionally coupled and enhance the invasiveness of cancer cells by increasing H(+) efflux.
21148407 Intracellular pH gradients established by NHE1 activity exist along the axis of cell movement.
21063092 The calmodulin binding site A of hNHE1 protein is responcible for the stimulation with angiotensin II, the calmodulin binding site B is important to maintain its basal activity.
21047280 This review focuses on the contribution of NHE-1 in atherogenesis and considers the relationship between NHE-1 and vascular risk factors of certain diseases, including hypertension and inflammation.
20974853 a structural model of the transmembrane part of hNHE1
20855896 Nedd4-1 and beta-arrestin-1 as key regulators of NHE1 ubiquitylation, endocytosis, and function.
20737315 The expression levels of NHE1 mRNA and protein are significantly up-regulated in gastric carcinoma tissue.
20609358 The AMP-dependent kinase AMPK is a powerful regulator of NHE1 activity and thus contributes to the regulation of cytosolic pH (pHi) and pHi-dependent metabolic pathways.
20561412 The expression of NHE1 is up-regulated during apoptosis of HL-60 cells induced by etoposide.
20547664 data show a concordance among NHE1 localization, the generation of a well-defined acidic extracellular pH in the nanospace surrounding invadopodia, and matrix-degrading activity at invadopodia of human malignant breast carcinoma cells
20542029 NHE1 is a potential target in breast cancer and in spite of their similar transport functions, NHE1 and NBCn1 serve different functions in MCF-7 cells
20427472 Results suggest that the association of NHE-1 with Na-K-ATPase is critical for ouabain-mediated regulation of Na-K-ATPase and that these effects may play a role in cardioglycoside-stimulated hypertension.
20338684 NHE1 plays a role in hepatocellular carcinoma (HCC) invasion and that NHE1 may be a potential therapeutic target for HCC treatment.
20138826 neurotensin /NTR1 signaling in pancreatic cancer cells seems to promote the induction of a metastatic phenotype, in contrast to its varying effects on tumor cell proliferation.
19958503 results suggest that both NHE1 and MnSOD have peroxisome proliferator response elements binding motif in their upstream/promoter region and hence are regulated by PPAR upon ligand binding.
19887620 These data provide evidence for tumor-selective downregulation of NHE1 by activated PPARgamma
19876777 Over-expression of Na+/H+ exchanger 1 is associated with hepatocellular carcinoma.
19854014 Observational study of gene-disease association. (HuGE Navigator)
19835836 Structural and functional analysis of extracellular loop 2 of the Na(+)/H(+) exchanger.
19622752 Results predict that other functions shared by Akt and NHE1, including cell growth and survival, might be regulated by increased H(+) efflux.
19479940 The functional and molecular expression of NHEs in cultured human endolymphatic sac (ES) epithelial cells was determined and the effect of IFN-gamma on NHE function, was examined.
19301149 Inhibition of the Na+-H+ exchanger isoform 1 (NHE1) also inhibited leptin-induced superoxide anion production but at the same time amplified leptin-induced production of other oxidative species
19176522 analysis of transmembrane XI of the NHE1 isoform of the Na+/H+ exchanger
18996841 Membrane targeting and coupling of NHE1-integrinalphaIIbbeta3-NCX1 by lipid rafts following integrin-ligand interactions trigger Ca2+ oscillations.
18953413 HPV16 E7-dependent transformation activates NHE1 through a PKA-RhoA-induced inhibition of p38alpha.
18776042 Activation of NHE1 is sufficient to generate Ca2+ signals that induce cardiac hypertrophy and heart failure.
18757828 Protein kinase B/Akt phosphorylates and inhibits the cardiac Na+/H+ exchanger NHE1.
18701649 These findings jklconfirm a necessary function for NHE1 during apoptosis and reveal the critical regulatory sites that mediate the alkalinizing activity of NHE1 in the early stages of a cell death response.
18508767 The structure of a peptide representing amino acids 338-365 of NHE1 determined by using high resolution NMR in dodecylphosphocholine micelles showed two helical regions kinked with a large bend angle around a pivot point at amino acid Ser(351)
18508719 Enhanced activity of the cardiac Na+/H+ exchanger (NHE-1) after myocardial stretch is considered a key step of the signaling pathway leading to cardiac hypertrophy[REVIEW].
18480176 critical for countering renal tubular atrophy and chronic renal disease progression
18407588 NHE1 has a role in restraining the malignant behavior of human gastric carcinoma cells
18264982 Data suggest that localization of NHE-1 in membrane cholesterol- and caveolin-rich microdomains constitutes a novel physiological negative regulator of NHE-1 activity.
18263712 NHE1 regulates Ca(2+) signaling via the modulation of Ca(2+) release from the endoplasmic reticulum, contributing to the regulation of proliferation in brain pericytes.
18094149 These observations suggest that Na(+)/H(+) exchange plays a permissive role in cell motility but is not required for the initiation or development of the migratory response.
18094063 after the 4-wk sprint training period, the expression of the muscle Na+-K+ pump alpha1-subunit and Na+/H+-exchanger isoform 1 was higher
18003619 Data support a novel molecular function of Daxx as an upstream regulator of NHE1 in ischemic cell death.
17982256 Three MAPKs exhibit unique interrelationships with the Na(+)/H(+) exchanger, NHE1, after osmotic cell shrinkage:ERK1/2, JNK1/2 and p38 MAPK.
17981808 Model structure of the Na+/H+ exchanger 1 in human and E. coli
17943310 T84 human colon cells contain three isoforms of the Na+/H+ exchanger, NHE1, NHE2, and NHE4, but not the Cl-dependent NHE
17916606 NHE1 activity generates a proton gradient at the cell surface accompanied by the cells' ability to respond to changes in pH in melanoma
17913870 These data provide the first evidence that both EGF and S1P stimulate NHE activity in the syncytiotrophoblast; they appear to do so predominantly by activating the NHE1 isoform.
17894388 Epidermal growth factor upregulates NHE1 by post-translational regulation that is important for cervical cancer cell invasiveness.
17662110 Results support the view that the multiple charged residues identified in this study, along with several basic residues reported previously, participate in the regulation of the intracellular pH sensing of Na+/H+ exchanger 1.
17565280 We highlight evidence for the nontransport functions of NHE1 and describe how the structural functions are integrated with ion translocation to regulate a range of cellular processes[review]
17349711 Vpr-mediated NHE1 dyregulation is in part through GR pathway
17349711 EIPA, a potent and specific inhibitor of Na+/H+ exchanger activity, significantly inhibits the Nef internalization into M2-macrophages, indicating that Nef is imported by Na+/H+ exchanger (solute carrier family 9, subfamily A)
17339567 Review. The role of NHE-1 hyperactivity in cardiac overload, ischemia/reperfusion injury, and myocardial hypertrophy is discussed.
17332506 The NHERF1 PDZ2 domain regulates PKA-RhoA-p38-mediated NHE1 activation and invasion in breast tumor cells.
17209041 Both intact Ser(770) and Ser(771) were required for sustained acidosis-mediated activation of NHE1
17167226 the existence of a positive feedback loop between NHE1 and ERK can pose a barrier against apoptosis.
17073455 data support the view that dimerization of two active subunits are required for NHE1 to possess the exchange activity in the neutral pH(i) range
17050540 helix formation of the cytoplasmic region of NHE1 by calcineurin B homologous protein 1 is a prerequisite for generating the active form of NHE1
16861220 TM VII is a critical transmembrane segment structured as an interrupted helix, with several residues that are essential to both protein function and sensitivity to inhibition.
16710297 These findings suggest that CHP serves as an obligatory subunit that is required both for supporting the basic activity and regulating the pH-sensing of NHE1 via interactions between distinct parts of these proteins [CHP2].
16511206 crystallographic analysis of the human calcineurin homologous protein CHP2 bound to the cytoplasmic region of the Na+/H+ exchanger NHE1
16475831 carbonic anhydrase II binds to the penultimate group of 13 amino acids of the cytoplasmic tail of NHE1. a novel phosphorylation-regulated CAII binding site exists in distal amino acids of the NHE1 tail.
16306134 In conclusion, EGF protects esophageal epithelial cells against acid through NHE activation via Ca(2+)/calmodulin and the PKC pathway.
16002403 Data show that the Na+/H+ exchanger (NHE), NHE1, is functionally active in HEK 293 cells, and resides in lipid rafts or caveolae, which may create cellular microdomains where pH(i) is tightly regulated.
15843433 a pseudopodial-located RhoA/ROCK/p38/NHE1 signal module is regulated by Protein Kinase A gating and then regulates invasion in breast cancer cell lines
15823043 The results suggest that PP1 is an important regulatory phosphatase of NHE1, that it can bind to and dephosphorylate the protein, and that it regulates NHE1 activity in vivo.
15772858 NHE activity in the microvillus of syncytiotrophoblasts is attributable predominantly to NHE1.
15677483 Transmembrane (TM) segment IV of Na+/H+ exchanger isoform 1 (NHE1) is an unusually structured TM segment exquisitely sensitive to mutagenesis and Phe161 is a pore-lining residue.
15610042 acidic aa sequence is critical in proper conformation of the cytosolic domain, calmodulin binding, and in activity
15535843 The antagonistic roles of RhoA and Rac1 in cell motility/invasion and cytoskeletal organization in breast cancer may be due to their concerted action on NHE1 activity as a convergence point.
15523538 The relative fluorescence density of NHE-1 is significantly higher in isolated liver nuclei of human, when compared with those of rabbit and rat.
15465015 Results describe the topogenesis of a hydrophobic lumenal loop segment between transmembrane segments 9 and 10 of human sodium/hydrogen exchanger isoform 1.
15269707 Children with higher baseline Na-Li countertransporter(CT) had greater blood pressure change than children in lower baseline Na-Li CT and were associated with greater risk of high blood pressure compared to lower Na-Li CT.
15096511 NHE1 promotes cell survival by dual mechanisms: by defending cell volume and pH(i) through Na(+)/H(+) exchange and by functioning as a scaffold for recruitment of a signalplex that includes ERM, phosphoinositide 3-kinase, and Akt
15035633 Association of NHE1 with calcineurin B homologous protein (CHP) is crucial for maintenance of the pH(i) sensitivity of NHE1; tightly bound Ca2+ ions may serve as important structural elements in the pHi sensor of NHE1.
14680478 Both Pro167 and Pro168 are strictly required for NHE function and may play critical roles in the structure of transmembrane segment IV of the NHE.
12905871 Observational study of gene-disease association. (HuGE Navigator)
12765964 identification in human reticulocytes and erythrocytes of an alternative splicing of NHE lacking the amiloride binding site
12682826 Regulation of placental NHE-1 not due to differences in C-terminus structure. Suppression regulated post-transcriptionally. Change in NHE-1 may contribute to adequate provision of electrolytes and nutrients to fetus.
12562776 both Arg(440) in IL5 and Gly residues in the conserved segment of TM11 appear to constitute important elements for proper functioning of the putative "pH(i) sensor" of Na(+)/H(+) exchanger 1.
12479094 MCT1 and NHE1 genes play important regulation roles in proliferation and growth of tumor cells, probably by affecting pHi.
12226101 serum-independent activation of NHE1 by bound CHP2 is one of the key mechanisms for the maintenance of high pH(i) and the resistance to serum deprivation-induced cell death in malignantly transformed cells
12065894 Data indicate for the first time that two acid extruders, Na(+)-H(+) exchanger and Na(+)-HCO(3)(-) symporter, exist functionally and pH(i) dependently in human atrial cardiomyocytes.
11852051 Anion exchanger isoform 2 operates in parallel with Na(+)/H(+) exchanger isoform 1 during regulatory cell volume decrease.

AA Sequence

MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPE      1 - 70
SRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFHVIPTISSIVPESCLLIVVGL     71 - 140
LVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLMYA    141 - 210
VCLVGGEQINNIGLLDNLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEF    211 - 280
ANYEHVGIVDIFLGFLSFFVVALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHL    281 - 350
SGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF    351 - 420
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLFLTAIITVIFF    421 - 490
TVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKK    491 - 560
CLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSAVSTVSMQNIHPKSLPSERILPALSKDKEEE    561 - 630
IRKILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRAR    631 - 700
IGSDPLAYEPKEDLPVITIDPASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETS    701 - 770
SPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ                             771 - 815
//

Text Mined References (190)

PMID Year Title
27083547 2016 The human Na(+)/H(+) exchanger 1 is a membrane scaffold protein for extracellular signal-regulated kinase 2.
26821117 2016 Are NHE1 and inducible nitric oxide synthase involved in human ovarian cancer?
26775040 2016 Na+/H+ exchanger 1, Na+/Ca2+ exchanger 1 and calmodulin complex regulates interleukin 6-mediated cellular behavior of human hepatocellular carcinoma.
26646587 2016 GPER is involved in the stimulatory effects of aldosterone in breast cancer cells and breast tumor-derived endothelial cells.
26397063 2015 Elevation of miR-27b by HPV16 E7 inhibits PPAR? expression and promotes proliferation and invasion in cervical carcinoma cells.
25802333 2015 Induction of heme oxygenase-1 by Na+-H+ exchanger 1 protein plays a crucial role in imatinib-resistant chronic myeloid leukemia cells.
25760855 2015 A novel human mutation in the SLC9A1 gene results in abolition of Na+/H+ exchanger activity.
25748234 2015 A novel NHE1-centered signaling cassette drives epidermal growth factor receptor-dependent pancreatic tumor metastasis and is a target for combination therapy.
25724898 2015 CIAPIN1 targets Na?/H? exchanger 1 to mediate MDA-MB-231 cells' metastasis through regulation of MMPs via ERK1/2 signaling pathway.
25677682 2015 Targeting osteopontin, the silent partner of Na+/H+ exchanger isoform 1 in cardiac remodeling.
25620102 2015 Ion transporters in brain tumors.
25514463 2015 The Na?/H? exchanger (NHE1) as a novel co-adjuvant target in paclitaxel therapy of triple-negative breast cancer cells.
25372487 2014 [Pt(O,O'-acac)(?-acac)(DMS)] alters SH-SY5Y cell migration and invasion by the inhibition of Na+/H+ exchanger isoform 1 occurring through a PKC-?/ERK/mTOR Pathway.
25350536 2014 Functional role of arginine 425 in the mammalian Na?/H? exchanger.
25275700 2014 Functional interdependence of NHE1 and merlin in human melanoma cells.
25241983 2014 Functional characterization of intracellular pH regulators responsible for acid extrusion in human radial artery smooth muscle cells.
25205112 2015 Mutation of SLC9A1, encoding the major Na?/H? exchanger, causes ataxia-deafness Lichtenstein-Knorr syndrome.
25190744 2014 Concurrent speed endurance and resistance training improves performance, running economy, and muscle NHE1 in moderately trained runners.
25162926 2014 Characterization of human mutations in phosphorylatable amino acids of the cytosolic regulatory tail of SLC9A1.
25043809 2014 CIAPIN1 targets Na+/H+ exchanger 1 to mediate K562 chronic myeloid leukemia cells' differentiation via ERK1/2 signaling pathway.
24891603 2014 Talin regulates moesin-NHE-1 recruitment to invadopodia and promotes mammary tumor metastasis.
24840010 2014 Structural and functional analysis of the transmembrane segment pair VI and VII of the NHE1 isoform of the Na+/H+ exchanger.
24717311 2014 Upregulation of NHE1 protein expression enables glioblastoma cells to escape TMZ-mediated toxicity via increased H? extrusion, cell migration and survival.
24594116 2014 Probucol via inhibition of NHE1 attenuates LPS-accelerated atherosclerosis and promotes plaque stability in vivo.
24434427 2014 CD44 targets Na(+)/H(+) exchanger 1 to mediate MDA-MB-231 cells' metastasis via the regulation of ERK1/2.
24378530 2014 Protein kinase C-? mediates neuronal activation of Na(+)/H(+) exchanger-1 during glutamate excitotoxicity.
24337203 2014 Protease activity at invadopodial focal digestive areas is dependent on NHE1-driven acidic pHe.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24136992 2014 Na+/H+ exchanger 1 is regulated via its lipid-interacting domain, which functions as a molecular switch: a pharmacological approach using indolocarbazole compounds.
24088894 2013 Calmodulin-dependent binding to the NHE1 cytosolic tail mediates activation of the Na+/H+ exchanger by Ca2+ and endothelin.
23902689 2013 NaV1.5 Na? channels allosterically regulate the NHE-1 exchanger and promote the activity of breast cancer cell invadopodia.
23837875 2013 Aberrant dynamin 2-dependent Na(+) /H(+) exchanger-1 trafficking contributes to cardiomyocyte apoptosis.
23678047 2013 Acidosis-mediated regulation of the NHE1 isoform of the Na?/H? exchanger in renal cells.
23677982 2013 NHE1 is the sodium-hydrogen exchanger active in acute intracellular pH regulation in preimplantation mouse embryos.
23602949 2013 Structural changes in the C-terminal regulatory region of the Na?/H? exchanger mediate phosphorylation induced regulation.
23429008 2013 NHE-1: still a viable therapeutic target.
23429007 2013 Regulation of the cardiac Na?/H? exchanger in health and disease.
23393197 2013 Regulation of the Na+/H+ Exchanger (NHE1) in Breast Cancer Metastasis.
23331996 2013 Evidence that Na+/H+ exchanger 1 is an ATP-binding protein.
23303189 2013 Chaperone stress 70 protein (STCH) binds and regulates two acid/base transporters NBCe1-B and NHE1.
23224899 2013 The role of Na(+)/h (+) exchanger isoform 1 in inflammatory responses: maintaining H(+) homeostasis of immune cells.
23220151 2013 Structural and functional insights into the cardiac Na?/H? exchanger.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184727 2013 The Na+ /H+ -exchanger (NHE1) generates pH nanodomains at focal adhesions.
22984264 2012 N-myristoylation and Ca2+ binding of calcineurin B homologous protein CHP3 are required to enhance Na+/H+ exchanger NHE1 half-life and activity at the plasma membrane.
22922957 2012 Extracellular acidification activates cAMP responsive element binding protein via Na+/H+ exchanger isoform 1-mediated Ca²? oscillation in central nervous system pericytes.
22772156 2012 Structural and functional analysis of extracellular loop 4 of the Nhe1 isoform of the Na(+)/H(+) exchanger.
22718548 2012 DNA hypermethylation and 1p Loss silence NHE-1 in oligodendroglioma.
22688515 2012 Na(+)/H(+) exchanger 1 directly binds to calcineurin A and activates downstream NFAT signaling, leading to cardiomyocyte hypertrophy.
22494070 2012 Na+/H+ exchanger 1 inhibition contributes to K562 leukaemic cell differentiation.
22301060 2012 Increased Na+/H+ exchanger activity on the apical surface of a cilium-deficient cortical collecting duct principal cell model of polycystic kidney disease.
22270364 2012 Integrin-mediated membrane blebbing is dependent on sodium-proton exchanger 1 and sodium-calcium exchanger 1 activity.
22216126 2011 Hypoxia-induced invadopodia formation involves activation of NHE-1 by the p90 ribosomal S6 kinase (p90RSK).
22138972 2012 NHE1 activity contributes to migration and is necessary for proliferation of human gastric myofibroblasts.
22120673 2012 The Na+/H+ exchanger NHE1, but not the Na+, HCO3(-) cotransporter NBCn1, regulates motility of MCF7 breast cancer cells expressing constitutively active ErbB2.
21997166 2012 NHE1 mediates migration and invasion of HeLa cells via regulating the expression and localization of MT1-MMP.
21931166 2011 Structure of human Na+/H+ exchanger NHE1 regulatory region in complex with calmodulin and Ca2+.
21867601 2011 [Na(+)/H(+) exchanger 1 expression and its effect on apoptosis in K562 and HL-60 cells with DNA damage].
21729545 2011 [Inhibition of NHE1 promotes hypoxia-induced differentiation of K562 leukemic cells].
21669197 2011 NHE1 mediates MDA-MB-231 cells invasion through the regulation of MT1-MMP.
21553168 2011 Controlled release systems containing solid dispersions: strategies and mechanisms.
21454803 2011 Silencing of sodium-hydrogen exchanger 1 attenuates the proliferation, hypertrophy, and migration of pulmonary artery smooth muscle cells via E2F1.
21425832 2011 The intracellular distal tail of the Na+/H+ exchanger NHE1 is intrinsically disordered: implications for NHE1 trafficking.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21413028 2011 High capacity Na+/H+ exchange activity in mineralizing osteoblasts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21392185 2011 Nuclear accumulation of calcineurin B homologous protein 2 (CHP2) results in enhanced proliferation of tumor cells.
21359875 2011 Activated NHE1 is required to induce early cardiac hypertrophy in mice.
21349616 2011 Potential role of NHE1 (sodium-hydrogen exchanger 1) in the cellular dysfunction of lactic acidosis: implications for treatment.
21345796 2011 B-Raf associates with and activates the NHE1 isoform of the Na+/H+ exchanger.
21261728 2011 Expression and modulation of Na(+) /H(+) exchanger 1 gene in hepatocellular carcinoma: A potential therapeutic target.
21221801 2011 Mechanism of regulation of Na-H exchanger in inflammatory bowel disease: role of TLR-4 signaling mechanism.
21185840 2011 Suppression of NHE1 by small interfering RNA inhibits HIF-1?-induced angiogenesis in vitro via modulation of calpain activity.
21170089 2011 Na(V)1.5 enhances breast cancer cell invasiveness by increasing NHE1-dependent H(+) efflux in caveolae.
21148407 2011 Intracellular pH gradients in migrating cells.
21063092 2010 Regulation of Na+/H+ exchanger isoform 1 (NHE1) by calmodulin-binding sites: role of angiotensin II.
21047280 2010 Na+ H+ exchanger-1: a link with atherogenesis?
20974853 2011 Structural modeling and electron paramagnetic resonance spectroscopy of the human Na+/H+ exchanger isoform 1, NHE1.
20855896 2010 Nedd4-1 and beta-arrestin-1 are key regulators of Na+/H+ exchanger 1 ubiquitylation, endocytosis, and function.
20737315 2010 [Expression of Na+-H+ exchanger 1 in human gastric carcinoma tissue and its clinical significance].
20609358 2010 Upregulation of Na+/H+ exchanger by the AMP-activated protein kinase.
20561412 2010 [Role of Na(+)/H(+) exchanger 1 in apoptosis of HL-60 cells induced by etoposide and its mechanism].
20547664 2010 NHE1 promotes invadopodial ECM proteolysis through acidification of the peri-invadopodial space.
20542029 2010 NBCn1 and NHE1 expression and activity in DeltaNErbB2 receptor-expressing MCF-7 breast cancer cells: contributions to pHi regulation and chemotherapy resistance.
20427472 2010 Ouabain stimulates Na-K-ATPase through a sodium/hydrogen exchanger-1 (NHE-1)-dependent mechanism in human kidney proximal tubule cells.
20338684 2010 Inhibition of Na(+)/H(+) exchanger 1 by 5-(N-ethyl-N-isopropyl) amiloride reduces hypoxia-induced hepatocellular carcinoma invasion and motility.
20138826 2010 Activation of Na+/H+ exchanger 1 by neurotensin signaling in pancreatic cancer cell lines.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19958503 2009 Computational identification and experimental validation of PPRE motifs in NHE1 and MnSOD genes of human.
19887620 2009 Repression of NHE1 expression by PPARgamma activation is a potential new approach for specific inhibition of the growth of tumor cells in vitro and in vivo.
19876777 2010 Over-expression of Na+/H+ exchanger 1 and its clinicopathologic significance in hepatocellular carcinoma.
19854014 2010 Genetic susceptibility to febrile seizures: case-control association studies.
19835836 2009 Structural and functional analysis of extracellular loop 2 of the Na(+)/H(+) exchanger.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19622752 2009 The sodium-hydrogen exchanger NHE1 is an Akt substrate necessary for actin filament reorganization by growth factors.
19479940 2009 Interferon-gamma suppresses Na+ -H+ exchanger in cultured human endolymphatic sac epithelial cells.
19301149 2009 The ambiguous role of the Na+-H+ exchanger isoform 1 (NHE1) in leptin-induced oxidative stress in human monocytes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19176522 2009 Structural and functional analysis of transmembrane XI of the NHE1 isoform of the Na+/H+ exchanger.
18996841 2009 Membrane targeting and coupling of NHE1-integrinalphaIIbbeta3-NCX1 by lipid rafts following integrin-ligand interactions trigger Ca2+ oscillations.
18953413 2008 HPV16 E7-dependent transformation activates NHE1 through a PKA-RhoA-induced inhibition of p38alpha.
18776042 2008 Activation of Na+/H+ exchanger 1 is sufficient to generate Ca2+ signals that induce cardiac hypertrophy and heart failure.
18757828 2008 Protein kinase B/Akt phosphorylates and inhibits the cardiac Na+/H+ exchanger NHE1.
18701649 2008 Apoptosis-induced alkalinization by the Na+/H+ exchanger isoform 1 is mediated through phosphorylation of amino acids Ser726 and Ser729.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18508767 2008 Structural and functional characterization of transmembrane segment IX of the NHE1 isoform of the Na+/H+ exchanger.
18508719 2008 Early signals after stretch leading to cardiac hypertrophy. Key role of NHE-1.
18480176 2008 Regulation of cell survival by Na+/H+ exchanger-1.
18407588 2008 Effect of NHE1 antisense gene transfection on the biological behavior of SGC-7901 human gastric carcinoma cells.
18264982 2008 Regulation of Na+/H+ exchanger 1 allosteric balance by its localization in cholesterol- and caveolin-rich membrane microdomains.
18263712 2008 Role of NHE1 in calcium signaling and cell proliferation in human CNS pericytes.
18094149 2008 Na+/H+ exchange and pH regulation in the control of neutrophil chemokinesis and chemotaxis.
18094063 2008 Reduced volume but increased training intensity elevates muscle Na+-K+ pump alpha1-subunit and NHE1 expression as well as short-term work capacity in humans.
18088087 2008 Phosphoproteome of resting human platelets.
18003619 2008 Physical interactions and functional coupling between Daxx and sodium hydrogen exchanger 1 in ischemic cell death.
17982256 2007 The Na+/H+ exchanger, NHE1, differentially regulates mitogen-activated protein kinase subfamilies after osmotic shrinkage in Ehrlich Lettre Ascites cells.
17981808 2007 Model structure of the Na+/H+ exchanger 1 (NHE1): functional and clinical implications.
17943310 2008 NHE1, NHE2, and NHE4 contribute to regulation of cell pH in T84 colon cancer cells.
17916606 2007 pH dependence of melanoma cell migration: protons extruded by NHE1 dominate protons of the bulk solution.
17913870 2007 Epidermal growth factor and sphingosine-1-phosphate stimulate Na+/H+ exchanger activity in the human placental syncytiotrophoblast.
17894388 2008 EGF upregulates Na+/H+ exchanger NHE1 by post-translational regulation that is important for cervical cancer cell invasiveness.
17662110 2007 Functional importance of charged residues within the putative intracellular loops in pH regulation by Na+/ H+ exchanger NHE1.
17565280 2007 Beyond ion translocation: structural functions of the sodium-hydrogen exchanger isoform-1.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17349711 2007 Human immunodeficiency virus (HIV-1) Vpr induced downregulation of NHE1 induces alteration in intracellular pH and loss of ERM complex in target cells.
17339567 2007 Sodium-hydrogen exchanger, cardiac overload, and myocardial hypertrophy.
17332506 2007 The NHERF1 PDZ2 domain regulates PKA-RhoA-p38-mediated NHE1 activation and invasion in breast tumor cells.
17209041 2007 Mitogen-activated protein kinase-dependent activation of the Na+/H+ exchanger is mediated through phosphorylation of amino acids Ser770 and Ser771.
17167226 2006 Inhibition of the Na+-H+ exchanger isoform-1 and the extracellular signal-regulated kinase induces apoptosis: a time course of events.
17073455 2006 Dimerization is crucial for the function of the Na+/H+ exchanger NHE1.
17050540 2007 Solution structure of the cytoplasmic region of Na+/H+ exchanger 1 complexed with essential cofactor calcineurin B homologous protein 1.
16861220 2006 Structural and functional characterization of transmembrane segment VII of the Na+/H+ exchanger isoform 1.
16717153 2006 Inhibiting p90 ribosomal S6 kinase prevents (Na+)-H+ exchanger-mediated cardiac ischemia-reperfusion injury.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16710297 2006 Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation.
16511206 2005 Crystallization and preliminary crystallographic analysis of the human calcineurin homologous protein CHP2 bound to the cytoplasmic region of the Na+/H+ exchanger NHE1.
16475831 2006 A novel carbonic anhydrase II binding site regulates NHE1 activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16306134 2006 Roles of epidermal growth factor and Na+/H+ exchanger-1 in esophageal epithelial defense against acid-induced injury.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16002403 2005 Localized Na+/H+ exchanger 1 expression protects Ca2+-regulated adenylyl cyclases from changes in intracellular pH.
15843433 2005 Protein kinase A gating of a pseudopodial-located RhoA/ROCK/p38/NHE1 signal module regulates invasion in breast cancer cell lines.
15823043 2005 Protein phosphatase regulation of Na+/H+ exchanger isoform I.
15772858 2005 Activity and expression of Na+/H+ exchanger isoforms in the syncytiotrophoblast of the human placenta.
15677483 2005 Structural and functional characterization of transmembrane segment IV of the NHE1 isoform of the Na+/H+ exchanger.
15610042 2004 Functional analysis of acidic amino acids in the cytosolic tail of the Na+/H+ exchanger.
15535843 2004 The Na+-H+ exchanger-1 induces cytoskeletal changes involving reciprocal RhoA and Rac1 signaling, resulting in motility and invasion in MDA-MB-435 cells.
15523538 Immunofluorescence revealed the presence of NHE-1 in the nuclear membranes of rat cardiomyocytes and isolated nuclei of human, rabbit, and rat aortic and liver tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15465015 2004 Topogenesis of NHE1: direct insertion of the membrane loop and sequestration of cryptic glycosylation and processing sites just after TM9.
15269707 2004 Baseline Na-Li countertransport and risk of hypertension in children: a 10-year prospective study in Hanzhong children.
15253667 2004 Open tubular immobilized metal ion affinity chromatography combined with MALDI MS and MS/MS for identification of protein phosphorylation sites.
15105296 2004 Functional relevance of the stretch-dependent slow force response in failing human myocardium.
15096511 2004 The NHE1 Na+/H+ exchanger recruits ezrin/radixin/moesin proteins to regulate Akt-dependent cell survival.
15035633 2004 Role of calcineurin B homologous protein in pH regulation by the Na+/H+ exchanger 1: tightly bound Ca2+ ions as important structural elements.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14680478 2004 Proline residues in transmembrane segment IV are critical for activity, expression and targeting of the Na+/H+ exchanger isoform 1.
12905871 2001 [Relationship between alpha-ENaC gene Thr663Ala polymorphism and ischemic stroke].
12809501 2003 The Na+/H+ exchanger cytoplasmic tail: structure, function, and interactions with tescalcin.
12765964 2003 Alternative splicing of NHE-1 mediates Na-Li countertransport and associates with activity rate.
12682826 2003 Suppression of Na+-H+ exchanger-1 in placentas of type 2 diabetic pregnant women: possible functional implication.
12626508 2003 Hypertonicity activates Na+/H+ exchange through Janus kinase 2 and calmodulin.
12598940 2003 [Tissue-specific expression of Na+ -H+ exchanger isoforms at two developmental stages of human fetus].
12576672 2003 Calcineurin homologous protein isoform 2 (CHP2), Na+/H+ exchangers-binding protein, is expressed in intestinal epithelium.
12562776 2003 Mutations of Arg440 and Gly455/Gly456 oppositely change pH sensing of Na+/H+ exchanger 1.
12549930 2003 Evidence for involvement of the putative first extracellular loop in differential volume sensitivity of the Na+/H+ exchangers NHE1 and NHE2.
12479094 2002 [Effect of co-inhibition of MCT1 gene and NHE1 gene on proliferation and growth of human lung adenocarcinoma cells].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226101 2002 Expression of calcineurin B homologous protein 2 protects serum deprivation-induced cell death by serum-independent activation of Na+/H+ exchanger.
12138085 2002 Carbonic anhydrase II binds to and enhances activity of the Na+/H+ exchanger.
12065894 Intracellular pH regulatory mechanism in human atrial myocardium: functional evidence for Na(+)/H(+) exchanger and Na(+)/HCO(3)(-) symporter.
11852051 2002 Anion exchanger isoform 2 operates in parallel with Na(+)/H(+) exchanger isoform 1 during regulatory volume decrease of human cervical cancer cells.
11696366 2001 Human homolog of mouse tescalcin associates with Na(+)/H(+) exchanger type-1.
11604491 2001 Trophic factor withdrawal: p38 mitogen-activated protein kinase activates NHE1, which induces intracellular alkalinization.
11369779 2001 The Nck-interacting kinase (NIK) phosphorylates the Na+-H+ exchanger NHE1 and regulates NHE1 activation by platelet-derived growth factor.
11350981 2001 Calcineurin homologous protein as an essential cofactor for Na+/H+ exchangers.
11279064 2001 14-3-3 Binding to Na+/H+ exchanger isoform-1 is associated with serum-dependent activation of Na+/H+ exchange.
11163215 2000 Direct binding of the Na--H exchanger NHE1 to ERM proteins regulates the cortical cytoskeleton and cell shape independently of H(+) translocation.
10913675 2000 Silent polymorphisms within the coding region of human sodium/hydrogen exchanger isoform-1 cDNA in peripheral blood mononuclear cells of leukemia patients: A comparison with healthy controls.
10713111 2000 A novel topology model of the human Na(+)/H(+) exchanger isoform 1.
9688597 1998 Topological analysis of NHE1, the ubiquitous Na+/H+ exchanger using chymotryptic cleavage.
8967452 1996 Coimmunoprecipitation of a 24-kDa protein with NHE1, the ubiquitous isoform of the Na+/H+ exchanger.
8901634 1996 A calcineurin homologous protein inhibits GTPase-stimulated Na-H exchange.
8283968 1993 Cloning and analysis of the human myocardial Na+/H+ exchanger.
8068684 1994 The Na+/H+ exchanger NHE-1 possesses N- and O-linked glycosylation restricted to the first N-terminal extracellular domain.
2846238 1988 The human amiloride-sensitive Na+/H+ antiporter: localization to chromosome 1 by in situ hybridization.
2536298 1989 Molecular cloning, primary structure, and expression of the human growth factor-activatable Na+/H+ antiporter.
2154036 1990 Growth factors induce phosphorylation of the Na+/H+ antiporter, glycoprotein of 110 kD.
1979310 1990 The Na+/H+ antiporter: a "melt" polymorphism allows regional mapping to the short arm of chromosome 1.
1712287 1991 Molecular cloning and expression of a cDNA encoding the rabbit ileal villus cell basolateral membrane Na+/H+ exchanger.