Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.75
PubTator Score 20.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2844 2.3e-24
aldosterone-producing adenoma 664 4.8e-02
Disease Target Count Z-score Confidence
Swine influenza 9 3.861 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
aldosterone-producing adenoma -1.142 4.8e-02
lung carcinoma -1.300 2.3e-24

Gene RIF (3)

PMID Text
24898248 NCLX, but not LETM1, mediates Ca(2+) extrusion from mitochondria. By controlling the duration of matrix Ca(2+) elevations, NCLX contributes to the regulation of NAD(P)H production and to the conversion of Ca(2+) signals into redox changes.
15060069 NCLX catalyzes active Li(+)/Ca(2+) exchange.
14625281 NCKX6 is a novel member of the Na+/Ca2+ exchanger superfamily

AA Sequence

MAGRRLNLRWALSVLCVLLMAETVSGTRGSSTGAHISPQFPASGVNQTPVVDCRKVCGLNVSDRCDFIRT      1 - 70
NPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVA     71 - 140
GVTFLAFGNGAPDIFSALVAFSDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYM    141 - 210
VAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSS    211 - 280
NTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKD    281 - 350
DQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWL    351 - 420
FAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSA    421 - 490
CFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCL    491 - 560
LLFYLNFLVVALLTEFGVIHLKSM                                                  561 - 584
//

Text Mined References (13)

PMID Year Title
24898248 2014 NCLX protein, but not LETM1, mediates mitochondrial Ca2+ extrusion, thereby limiting Ca2+-induced NAD(P)H production and modulating matrix redox state.
23538132 2013 NCLX: the mitochondrial sodium calcium exchanger.
23506867 The SLC8 gene family of sodium-calcium exchangers (NCX) - structure, function, and regulation in health and disease.
23056385 2012 The mitochondrial Na+/Ca2+ exchanger upregulates glucose dependent Ca2+ signalling linked to insulin secretion.
22829870 2012 The mitochondrial Ca2+ uniporter MCU is essential for glucose-induced ATP increases in pancreatic ?-cells.
20018762 2010 NCLX is an essential component of mitochondrial Na+/Ca2+ exchange.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15060069 2004 Lithium-calcium exchange is mediated by a distinct potassium-independent sodium-calcium exchanger.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14625281 2004 Molecular cloning of a sixth member of the K+-dependent Na+/Ca2+ exchanger gene family, NCKX6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.