Property Summary

NCBI Gene PubMed Count 30
PubMed Score 53.26
PubTator Score 38.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -1.500 6.7e-03
osteosarcoma 1.264 7.5e-04
ependymoma -2.100 6.6e-11
sonic hedgehog group medulloblastoma -1.800 1.2e-03
atypical teratoid / rhabdoid tumor -2.200 7.7e-07
medulloblastoma, large-cell -2.300 1.8e-04
primitive neuroectodermal tumor -1.500 4.1e-02
pediatric high grade glioma -1.100 6.1e-03
acute myeloid leukemia -2.100 1.2e-02
pituitary cancer 1.300 2.5e-02

Protein-protein Interaction (5)

Gene RIF (16)

PMID Text
23919677 Ayloid beta mediates calpain cleavage of NCX3 in Alzheimer's disease brain.
23224891 human macrophages and monocytes express NCX1 and NCX3 that operate in a bidirectional manner to restore [Ca(2+)](i) to generate Ca(2+) signals and to induce TNF-alpha production.
23224890 Functional studies, as well as mRNA and protein expression analyses, revealed that NCX1 and NCX3, but not NCX2, were divergently modulated during OPC differentiation into oligodendrocyte.
23224887 the large cytosolic loop of NCX1, NCX2, and NCX3 is involved in acquisition of immunosuppressive drug specificity
23224884 NCX isoforms (NCX2, NCX3) contribute to mitochondrial Na(+)/Ca(2+) exchange in human DAergic neurons and may act downstream of PINK1 in the prevention of neurodegeneration by m[Ca(2+)] accumulation.
23224883 NCX1 and NCX3 -represent two promising druggable targets for setting on new strategies in stroke therapy.
21959935 calcium signaling mediated by NCX3 has a crucial role in oligodendrocyte maturation and myelin formation.
21858195 Data suggest that NCX-mediated Ca(2+) fluxes normally exist in human ASM (potentially contributing to rapid Ca(2+) fluxes), and contribute to enhanced [Ca(2+)](i) regulation in airway inflammation.
21790537 Human platelets express K(+) -independent Na(+) /Ca(2+) exchangers NCX1.3, NCX3.2 and NCX3.4.
21382638 Results demonstrate a selective regulation of NCX1, NCX2 and NCX3 isoforms in Alzheimer's disease cortex, specifically in terminals containing amyloid-beta.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16679322 plasma membrane Na+/Ca2+ exchangers have inhibitory interactions with the 14-3-3 proteins
16306395 The downregulation of the regulator of Ca2+ homeostasis NCX3 by Ca2+-regulated DREAM is a striking example of the autoregulatory property of the Ca2+ signal in neurons.
15777725 Studies show that both alternatively spliced variants can be translated into protein.
15247490 This review examines the regulatory features and expression pattern of the SLC8A3 gene which suggest that NCX3 activity could be crucial in neuronal functions such as memory formation and sensory processing.
12502570 The gene promoter of the human isoform of this protein is controlled by cAMP and calcium.

AA Sequence

MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVILPIWYPENPSL      1 - 70
GDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMA     71 - 140
LGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFITAAWS    141 - 210
IFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGD    211 - 280
HPKGIEMDGKMMNSHFLDGNLVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKS    281 - 350
RAFYRIQATRMMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVR    351 - 420
KGGDMSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRIE    421 - 490
EEQPEEGMPPAIFNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARG    491 - 560
TVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISA    561 - 630
LLLSPDVTDRKLTMEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRD    631 - 700
QFMEAITVSAAGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTA    701 - 770
IIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAW    771 - 840
SVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWL    841 - 910
LYILFATLEAYCYIKGF                                                         911 - 927
//

Text Mined References (34)

PMID Year Title
23919677 2014 Calpain cleavage and inactivation of the sodium calcium exchanger-3 occur downstream of A? in Alzheimer's disease.
23506867 The SLC8 gene family of sodium-calcium exchangers (NCX) - structure, function, and regulation in health and disease.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23224891 2013 Human macrophages and monocytes express functional Na(+)/Ca (2+) exchangers 1 and 3.
23224890 2013 New roles of NCX in glial cells: activation of microglia in ischemia and differentiation of oligodendrocytes.
23224887 2013 Immunosuppressive drugs, immunophilins, and functional expression of NCX isoforms.
23224884 2013 The role of the mitochondrial NCX in the mechanism of neurodegeneration in Parkinson's disease.
23224883 2013 NCX as a key player in the neuroprotection exerted by ischemic preconditioning and postconditioning.
22969067 2012 Genetic variants near PDGFRA are associated with corneal curvature in Australians.
21959935 2012 Silencing or knocking out the Na(+)/Ca(2+) exchanger-3 (NCX3) impairs oligodendrocyte differentiation.
21858195 2011 Sodium-calcium exchange in intracellular calcium handling of human airway smooth muscle.
21790537 2012 Molecular and functional characterization of the human platelet Na(+) /Ca(2+) exchangers.
21602797 2011 Genome-wide association and linkage identify modifier loci of lung disease severity in cystic fibrosis at 11p13 and 20q13.2.
21382638 2011 High levels of synaptosomal Na(+)-Ca(2+) exchangers (NCX1, NCX2, NCX3) co-localized with amyloid-beta in human cerebral cortex affected by Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16679322 2006 Inhibitory interaction of the plasma membrane Na+/Ca2+ exchangers with the 14-3-3 proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16306395 2005 Downstream regulatory element antagonist modulator regulates Ca2+ homeostasis and viability in cerebellar neurons.
15777725 2005 Molecular cloning and characterization of two novel truncated isoforms of human Na+/Ca2+ exchanger 3, expressed in fetal brain.
15557343 2005 Calcineurin inhibits Na+/Ca2+ exchange in phenylephrine-treated hypertrophic cardiomyocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247490 2004 Transcriptional regulation by cAMP and Ca2+ links the Na+/Ca2+ exchanger 3 to memory and sensory pathways.
14722618 2004 Impaired neuromuscular transmission and skeletal muscle fiber necrosis in mice lacking Na/Ca exchanger 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12558991 2003 Control of the Na+/Ca2+ exchanger 3 promoter by cyclic adenosine monophosphate and Ca2+ in differentiating neurons.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12502570 2002 The gene promoter of human Na+/Ca2+ exchanger isoform 3 (SLC8A3) is controlled by cAMP and calcium.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406570 2002 The human SLC8A3 gene and the tissue-specific Na+/Ca2+ exchanger 3 isoforms.
10390518 1999 Sodium/calcium exchange: its physiological implications.
9195292 1997 Na(+)-Ca2+ exchanger: physiology and pharmacology.
8921376 1996 The organization of the human gene NCX1 encoding the sodium-calcium exchanger.
8798769 1996 Cloning of a third mammalian Na+-Ca2+ exchanger, NCX3.