Property Summary

NCBI Gene PubMed Count 100
PubMed Score 236.38
PubTator Score 621.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Dementia 129 0.0 2.0
Heart conduction disease 65 0.0 2.0

Expression

  Differential Expression (29)

Disease log2 FC p
pancreatic cancer 1.200 3.6e-03
astrocytic glioma -2.700 9.7e-04
ependymoma -5.000 1.4e-22
oligodendroglioma -2.800 4.5e-16
glioblastoma -4.700 1.7e-06
osteosarcoma -1.489 2.3e-05
medulloblastoma -5.100 6.8e-08
cystic fibrosis -1.300 5.5e-04
atypical teratoid / rhabdoid tumor -5.300 4.5e-09
medulloblastoma, large-cell -4.600 2.0e-05
primitive neuroectodermal tumor -3.100 9.4e-03
tuberculosis 2.200 5.5e-07
non-small cell lung cancer -1.107 1.6e-13
intraductal papillary-mucinous adenoma (... -1.200 4.7e-02
intraductal papillary-mucinous carcinoma... -1.500 1.9e-02
intraductal papillary-mucinous neoplasm ... -2.000 2.8e-02
Hydrolethalus syndrome 1.395 2.9e-02
colon cancer -1.700 1.4e-05
pediatric high grade glioma -3.700 2.2e-06
pilocytic astrocytoma -3.200 2.3e-06
non primary Sjogren syndrome sicca -1.100 2.4e-02
pancreatic carcinoma 1.200 3.6e-03
psoriasis -1.400 7.6e-77
COPD -1.600 1.3e-03
Pick disease 1.500 6.1e-03
ulcerative colitis 1.100 1.5e-07
ovarian cancer -1.500 1.4e-02
pituitary cancer 2.400 9.0e-09
head and neck cancer -1.600 1.6e-02

 CSPA Cell Line (1)

Gene RIF (68)

PMID Text
27031991 The expression of miR-206 by HUVECs reduced exosome production by regulating ADP-Ribosylation Factor 6 (ARF6) and sodium/calcium exchanger 1 (NCX1).
26775040 interaction of NHE1, NCX1 and CaM mediates the effects of IL6 on human hepatocellular carcinoma
26567603 NCX1 operating in reverse mode plays a prominent role in calcium cytosolic regulation in highly metastatic melanoma cells.
26421717 results demonstrate that CaM senses changes in [Ca2+]i and binds to the cytoplasmic loop of NCX1 to regulate exchange activity.
26418956 NCX1.3 is the predominant NCX variant in the distal convoluted and connecting tubules tubules
26045217 ADD2 and NCX1 variants influence the risk and the clinical features of systemic lupus erythematosus and lupus nephritis.
25770213 These data confirm the role of NCX1 activity in regulating renal epithelial cell migration.
25589784 human osteoblasts and osteoblasts from Ano6(-/-) and WT mice, we demonstrate that NCX1 requires Ano6 to efficiently translocate Ca(2+) out of osteoblasts into the calcifying bone matrix
25500693 The expressions of NCX1 and NCKX4 were significantly higher in the patent ductus arteriosus group at both the protein and mRNA levels.
25481039 Down-regulation of the SLC8A1 gene, most likely mediated by its regulator miR-223, can lead to decreased calcium in penile carcinoma and consequently to suppressed apoptosis and increased tumor cell proliferation
25336645 CAPN1 anchors to two NCX1 regions and cleaves at methionine-369, leading to NCX1 inactivation in heart failure.
25055868 There is a functional role of sodium-calcium exchanger SLC8A1 in human atrial and atrioventricular nodal conduction as suggested by genetically modified mouse models.
25035420 Three novel loci were identified in East Asians with cardiac arrhythmias: rs2483280 (PRDM16 locus) and rs335206 (PRDM6 locus) were associated with QRS duration; and rs17026156 (SLC8A1 locus) correlated with PR interval.
24498266 Results indicate that levosimendan inhibited reverse-mode Na(+)/Ca(2+) exchanger (NCX) activity to protect cardiomyocyte progenitor cells (CPC)-derived cardiomyocytes from anoxia-reoxygenation (A/R)-induced ER stress and cell death.
23913256 NCX1 (and EAAT1) are both involved in glutamate-induced ATP synthesis, with NCX1 playing a pivotal role.
23376057 Biochemical support for a model of NCX1 with 10 transmembrane domains as found in the prokaryotic homologue.
23224892 NCX1 is a key component of certain distinct signaling pathways that activate VSM contraction in response to stretch (i.e., myogenic response) and to activation of certain G-protein-coupled receptors.
23224891 human macrophages and monocytes express NCX1 and NCX3 that operate in a bidirectional manner to restore [Ca(2+)](i) to generate Ca(2+) signals and to induce TNF-alpha production.
23224890 Functional studies, as well as mRNA and protein expression analyses, revealed that NCX1 and NCX3, but not NCX2, were divergently modulated during OPC differentiation into oligodendrocyte.
23224887 the large cytosolic loop of NCX1, NCX2, and NCX3 is involved in acquisition of immunosuppressive drug specificity
23224883 NCX1 and NCX3 -represent two promising druggable targets for setting on new strategies in stroke therapy.
23224875 the transcriptional network regulating Ncx1 expression is also mediating many of the other changes in genetic remodeling contributing to the development of cardiac dysfunction
23224872 Functional and structural properties of the NCKX2 Na(+)-Ca (2+)/K (+) exchanger: a comparison with the NCX1 Na (+)/Ca (2+) exchanger.
23224869 NCX1: mechanism of transport.
23192947 Ncx1 expression is required for increasing sinus rates and in isolated sinoatrial cells.
23069678 these results demonstrate that REST, by regulating NCX1 expression, may represent a potential druggable target for the treatment of brain ischemia
22842068 alpha(2)-Na(+) pumps, NCX1, receptor-operated channels, and the sarcoplasmic reticulum regulate Ca(2+) homeostasis and signaling in human arterial smooth muscle cells.
22726844 this study validated the association between a SNP, rs13017846, which maps to near SLC8A1 (sodium/calcium exchanger 1 precursor, overall p = 8.0 x 10(-14)), and the QT interval.
22479505 interaction of NCX1 and EAAC1 transporters leads to glutamate-enhanced ATP production in brain mitochondria
22456474 NCX1 is upregulated in chronic atrial fibrillation. A larger I(NCX) for a given SR Ca(2+) release contributes to AF-promoting atrial delayed afterdepolarizations/triggered activity in cAF patients.
22270364 a novel function for NHE1 and NCX1 in membrane blebbing and permeability, and establish a link between membrane blebbing and integrin signaling.
21930298 an essential component in the mechanism governing cardiac steroid-induced slow Ca(2+) oscillations
21873429 Ca(2+) influx through reverse mode NCX is required for the activation and the targeting of PKCalpha to the plasma membrane, an essential step for VEGF-induced ERK1/2 phosphorylation and downstream EC functions in angiogenesis
21858195 Data suggest that NCX-mediated Ca(2+) fluxes normally exist in human ASM (potentially contributing to rapid Ca(2+) fluxes), and contribute to enhanced [Ca(2+)](i) regulation in airway inflammation.
21833492 There were no differences of gene frequency between Alzheimer disease cases and controls for any of three polymorphisms of NCX1 gene. However, among AD patients whose age at onset (AAO) was >65 years, carriers of a 14 bp insertion showed a lower AAO.
21790537 Human platelets express K(+) -independent Na(+) /Ca(2+) exchangers NCX1.3, NCX3.2 and NCX3.4.
21613675 an increase in the NCX1 mRNA due to the apoptosis induction is not regulated by HIF-1alpha
21382638 Results demonstrate a selective regulation of NCX1, NCX2 and NCX3 isoforms in Alzheimer's disease cortex, specifically in terminals containing amyloid-beta.
21321244 Immunohistochemical analysis revealed thatNCKX3 and NCX1 were abundantly localized in the cytoplasm of luminal and glandular epithelial uterine cells throughout the menstrual cycle. NCX1 expression was not affected by estradiol and progesterone.
21126331 Taken together, these data demonstrate a potentially important role for NCX1 in control of Ca2+ homeostasis and link store depletion via STIM1 directly with NCX activation.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20173311 NCX1 protein expression in urinary bladder smooth muscle increases approximately 4-fold in NCX1.3 transgenic mice compared to that in wild-type.
20109173 characterization of NCX1 intronic hypervariable non-coding region enriched in human-specific indel variants
20109173 Observational study of gene-disease association. (HuGE Navigator)
20018762 Results show that the Na(+)/Ca(2+) exchanger NCLX is enriched in mitochondria, where it is localized to the cristae.
19830548 These results suggest that recovery from intracellular acidosis causes a transient increase in cytosolic Ca(2+) due to reversal of Ca(2+) transport via Na(+)/Ca(2+) exchanger coactivated with Na(+)/H(+) exchanger, which can cause cell death.
19541636 Results indicate the nuclear NCX/GM1 complex acts to gate Ca(2+) transfer from cytosol to ER, an alternate route to the sarcoplasmic/endoplasmic reticulum calcium ATPase pump.
18996841 Membrane targeting and coupling of NHE1-integrinalphaIIbbeta3-NCX1 by lipid rafts following integrin-ligand interactions trigger Ca2+ oscillations.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18635667 Data show that activity of beta-cell NCX1 splice variants is modulated by acyl-CoAs and is dependent upon the intrinsic properties of the NCX1 splice variant and on the side chain length and degree of saturation of the acyl-CoA moiety.
17912271 NKCC1 in conjunction with NCX1 plays a role in reperfusion-induced brain injury after ischemia.
17846126 Observational study of gene-disease association. (HuGE Navigator)
17541957 Results describe the involvement of the Na+-Ca2+ exchanger as well as the role of non-selective-cation channels in cardiac myofibroblast cell function in vitro.
16921169 PLM interacts with the intracellular loop of NCX1, most likely at residues 218-358
16679322 plasma membrane Na+/Ca2+ exchangers have inhibitory interactions with the 14-3-3 proteins
16399865 These results highlight the importance of ionic regulation in controlling NCX1 activity under conditions that promote Ca2+ overload.
16292983 an ankyrin-B-based macromolecular complex of Na/K ATPase, Na/Ca exchanger 1, and InsP3 receptor that is localized in cardiomyocyte T-tubules in discrete microdomains distinct from classic dihydropyridine receptor/ryanodine receptor "dyads
15824464 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15785003 Observational study of gene-disease association. (HuGE Navigator)
15785003 NCX1 is one of the genes related to susceptibility to essential hypertension in the Japanese general population.
15703175 Ca(2+) entry mode operation of the Na(+)/Ca(2+) exchanger is required for des-Arg(10)-kallidin- and TGF-beta1-stimulated fibrogenesis and participates in the maintenance of the myofibroblast phenotype
15033764 Overexpression increases apoptosis induced by endoplasmic reticulum ca-atpase inhibitors and activates caspase-12
14981087 collagen-induced increase in [Ca2+](i) in platelets is dependent on concentration of Na+ in the extracellular milieu: the collagen-induced increase in [Ca2+](i) causes reversal of the NCX, resulting in an increase in [Ca2+](i) and platelet aggregation
14736881 functional and physical interaction of nonselective TRPC cation channels with NCX proteins as a novel principle of TRPC-mediated Ca(2+) signaling.
12502539 Characterization and functional activity of a truncated Na/Ca exchange isoform resulting from a new splicing pattern
12031969 Na/Ca exchanger overexpression, by depleting ER Ca(2+) stores, triggers the activation of caspase-12 and increases apoptotic cell death
11916852 data are consistent with a stoichiometry for the NCX1.1 protein of 4 Na+ to 1 Ca2+ to 2 charges moved per transport cycle

AA Sequence

MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVILPIWEPQDPS      1 - 70
FGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETTKTTVRIWNETVSNLTLM     71 - 140
ALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAW    141 - 210
SIFAYTWLYIILSVISPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEG    211 - 280
DRPSSKTEIEMDGKVVNSHVENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELAN    281 - 350
YQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE    351 - 420
NCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDEN    421 - 490
FLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKV    491 - 560
LRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPR    561 - 630
LVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE    631 - 700
MGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKL    701 - 770
PSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVF    771 - 840
VALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFS    841 - 910
VTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIFFSSLEAYCHIKGF           911 - 973
//

Text Mined References (105)

PMID Year Title
27031991 2016 Endothelial Cells Can Regulate Smooth Muscle Cells in Contractile Phenotype through the miR-206/ARF6&NCX1/Exosome Axis.
26775040 2016 Na+/H+ exchanger 1, Na+/Ca2+ exchanger 1 and calmodulin complex regulates interleukin 6-mediated cellular behavior of human hepatocellular carcinoma.
26567603 2015 Sodium calcium exchanger operates in the reverse mode in metastatic human melanoma cells.
26421717 2015 Calmodulin Interacts with the Sodium/Calcium Exchanger NCX1 to Regulate Activity.
26418956 2015 The Na+/Ca2+ Exchanger 1 (NCX1) Variant 3 as the Major Extrusion System in Renal Distal Tubular Transcellular Ca2+-Transport.
26045217 2015 Beta-adducin and sodium-calcium exchanger 1 gene variants are associated with systemic lupus erythematosus and lupus nephritis.
25770213 2015 Sodium-calcium exchanger 1 regulates epithelial cell migration via calcium-dependent extracellular signal-regulated kinase signaling.
25589784 2015 Anoctamin-6 controls bone mineralization by activating the calcium transporter NCX1.
25500693 2015 Elevated NCX1 and NCKX4 expression in the patent postnatal ductus arteriosus of ductal-dependent congenital heart disease patients.
25481039 2015 Down-Regulation of SLC8A1 as a Putative Apoptosis Evasion Mechanism by Modulation of Calcium Levels in Penile Carcinoma.
25431337 2015 A common variant in RAB27A gene is associated with fractional exhaled nitric oxide levels in adults.
25336645 2014 Molecular basis of calpain cleavage and inactivation of the sodium-calcium exchanger 1 in heart failure.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
25055868 2014 Genome-wide association study of electrocardiographic parameters identifies a new association for PR interval and confirms previously reported associations.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
24498266 2014 Inhibition of reverse-mode sodium-calcium exchanger activity and apoptosis by levosimendan in human cardiomyocyte progenitor cell-derived cardiomyocytes after anoxia and reoxygenation.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23913256 2013 Glutamate-induced ATP synthesis: relationship between plasma membrane Na+/Ca2+ exchanger and excitatory amino acid transporters in brain and heart cell models.
23608603 2013 Na? transport in the normal and failing heart - remember the balance.
23563609 2013 Genome-wide SNP and CNV analysis identifies common and low-frequency variants associated with severe early-onset obesity.
23506867 The SLC8 gene family of sodium-calcium exchangers (NCX) - structure, function, and regulation in health and disease.
23376057 2013 The topology of the cardiac Na?/Ca²? exchanger, NCX1.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23224892 2013 New insights into the contribution of arterial NCX to the regulation of myogenic tone and blood pressure.
23224891 2013 Human macrophages and monocytes express functional Na(+)/Ca (2+) exchangers 1 and 3.
23224890 2013 New roles of NCX in glial cells: activation of microglia in ischemia and differentiation of oligodendrocytes.
23224887 2013 Immunosuppressive drugs, immunophilins, and functional expression of NCX isoforms.
23224883 2013 NCX as a key player in the neuroprotection exerted by ischemic preconditioning and postconditioning.
23224879 2013 Coordinated regulation of cardiac Na(+)/Ca (2+) exchanger and Na (+)-K (+)-ATPase by phospholemman (FXYD1).
23224875 2013 Transcriptional pathways and potential therapeutic targets in the regulation of Ncx1 expression in cardiac hypertrophy and failure.
23224872 2013 Functional and structural properties of the NCKX2 Na(+)-Ca (2+)/K (+) exchanger: a comparison with the NCX1 Na (+)/Ca (2+) exchanger.
23224869 2013 NCX1: mechanism of transport.
23192947 2013 Genetic inhibition of Na+-Ca2+ exchanger current disables fight or flight sinoatrial node activity without affecting resting heart rate.
23069678 2013 NCX1 is a new rest target gene: role in cerebral ischemia.
22842068 2012 Nanomolar ouabain increases NCX1 expression and enhances Ca2+ signaling in human arterial myocytes: a mechanism that links salt to increased vascular resistance?
22726844 2012 A common variant in SLC8A1 is associated with the duration of the electrocardiographic QT interval.
22628157 2012 Genome-wide association study of neurocognitive impairment and dementia in HIV-infected adults.
22479505 2012 Physical and functional interaction of NCX1 and EAAC1 transporters leading to glutamate-enhanced ATP production in brain mitochondria.
22456474 2012 Enhanced sarcoplasmic reticulum Ca2+ leak and increased Na+-Ca2+ exchanger function underlie delayed afterdepolarizations in patients with chronic atrial fibrillation.
22270364 2012 Integrin-mediated membrane blebbing is dependent on sodium-proton exchanger 1 and sodium-calcium exchanger 1 activity.
21930298 2011 The Na(+)/Ca(2+)-exchanger: an essential component in the mechanism governing cardiac steroid-induced slow Ca(2+) oscillations.
21873429 2011 Ca2+ influx through reverse mode Na+/Ca2+ exchange is critical for vascular endothelial growth factor-mediated extracellular signal-regulated kinase (ERK) 1/2 activation and angiogenic functions of human endothelial cells.
21858195 2011 Sodium-calcium exchange in intracellular calcium handling of human airway smooth muscle.
21833492 2012 A 14 bp indel variation in the NCX1 gene modulates the age at onset in late-onset Alzheimer's disease.
21790537 2012 Molecular and functional characterization of the human platelet Na(+) /Ca(2+) exchangers.
21613675 2011 Chemically mimicked hypoxia modulates gene expression and protein levels of the sodium calcium exchanger in HEK 293 cell line via HIF-1?.
21382638 2011 High levels of synaptosomal Na(+)-Ca(2+) exchangers (NCX1, NCX2, NCX3) co-localized with amyloid-beta in human cerebral cortex affected by Alzheimer's disease.
21321244 2011 Distinct expression of the calcium exchangers, NCKX3 and NCX1, and their regulation by steroid in the human endometrium during the menstrual cycle.
21126331 2010 Reverse mode Na+/Ca2+ exchange mediated by STIM1 contributes to Ca2+ influx in airway smooth muscle following agonist stimulation.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20173311 2010 Cellular Ca2+ dynamics in urinary bladder smooth muscle from transgenic mice overexpressing Na+-Ca2+ exchanger.
20109173 2010 Hypervariable intronic region in NCX1 is enriched in short insertion-deletion polymorphisms and showed association with cardiovascular traits.
20018762 2010 NCLX is an essential component of mitochondrial Na+/Ca2+ exchange.
19830548 2010 Change in intracellular pH causes the toxic Ca2+ entry via NCX1 in neuron- and glia-derived cells.
19541636 2009 Sodium-calcium exchanger complexed with GM1 ganglioside in nuclear membrane transfers calcium from nucleoplasm to endoplasmic reticulum.
19481548 2009 Reactive oxygen species directly modify sodium-calcium exchanger activity in a splice variant-dependent manner.
19095005 2009 New molecular components supporting ryanodine receptor-mediated Ca(2+) release: roles of junctophilin and TRIC channel in embryonic cardiomyocytes.
18996841 2009 Membrane targeting and coupling of NHE1-integrinalphaIIbbeta3-NCX1 by lipid rafts following integrin-ligand interactions trigger Ca2+ oscillations.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18635667 2008 Splice variant-dependent regulation of beta-cell sodium-calcium exchange by acyl-coenzyme As.
17912271 2008 A concerted role of Na+ -K+ -Cl- cotransporter and Na+/Ca2+ exchanger in ischemic damage.
17846126 2007 Identification of novel candidate genes for type 2 diabetes from a genome-wide association scan in the Old Order Amish: evidence for replication from diabetes-related quantitative traits and from independent populations.
17614935 2007 Regulation and role of the presynaptic and myocardial Na+/H+ exchanger NHE1: effects on the sympathetic nervous system in heart failure.
17541957 2007 The participation of the Na+-Ca2+ exchanger in primary cardiac myofibroblast migration, contraction, and proliferation.
17178715 2007 Targeting and stability of Na/Ca exchanger 1 in cardiomyocytes requires direct interaction with the membrane adaptor ankyrin-B.
16921169 2006 Cytoplasmic tail of phospholemman interacts with the intracellular loop of the cardiac Na+/Ca2+ exchanger.
16679322 2006 Inhibitory interaction of the plasma membrane Na+/Ca2+ exchangers with the 14-3-3 proteins.
16399865 2006 Cells expressing unique Na+/Ca2+ exchange (NCX1) splice variants exhibit different susceptibilities to Ca2+ overload.
16314582 2005 Calcium extrusion is critical for cardiac morphogenesis and rhythm in embryonic zebrafish hearts.
16292983 2005 Ankyrin-B coordinates the Na/K ATPase, Na/Ca exchanger, and InsP3 receptor in a cardiac T-tubule/SR microdomain.
15824464 2004 The thiazide-sensitive Na(+)-Cl(-) cotransporter gene, C1784T, and adrenergic receptor-beta3 gene, T727C, may be gene polymorphisms susceptible to the antihypertensive effect of thiazide diuretics.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15785003 2004 Association of genetic polymorphisms of sodium-calcium exchanger 1 gene, NCX1, with hypertension in a Japanese general population.
15703175 2005 Na+/Ca2+ exchanger activity modulates connective tissue growth factor mRNA expression in transforming growth factor beta1- and Des-Arg10-kallidin-stimulated myofibroblasts.
15557343 2005 Calcineurin inhibits Na+/Ca2+ exchange in phenylephrine-treated hypertrophic cardiomyocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15105296 2004 Functional relevance of the stretch-dependent slow force response in failing human myocardium.
15033764 2003 Na/Ca exchanger overexpression induces endoplasmic reticulum stress, caspase-12 release, and apoptosis.
14981087 2004 Mechanism of collagen activation in human platelets.
14736881 2004 Ca(2+) signaling by TRPC3 involves Na(+) entry and local coupling to the Na(+)/Ca(2+) exchanger.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14593108 2004 Plasma membrane-cytoskeleton-endoplasmic reticulum complexes in neurons and astrocytes.
12502539 2002 Characterization and functional activity of a truncated Na/Ca exchange isoform resulting from a new splicing pattern of NCX1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12031969 2002 Na/Ca exchanger overexpression induces endoplasmic reticulum-related apoptosis and caspase-12 activation in insulin-releasing BRIN-BD11 cells.
11916852 2002 Stoichiometry of the Cardiac Na+/Ca2+ exchanger NCX1.1 measured in transfected HEK cells.
11821059 2002 Evidence for cardiac sodium-calcium exchanger association with caveolin-3.
11350050 2001 Identification and characterization of a sodium/calcium exchanger, NCX-1, in osteoclasts and its role in bone resorption.
11241183 2001 NCX1 Na/Ca exchanger splice variants in pancreatic islet cells.
10908415 2000 Na+/Ca2+ exchanger isoforms of rat odontoblasts and osteoblasts.
10536662 1999 Heterogeneous transmural gene expression of calcium-handling proteins and natriuretic peptides in the failing human heart.
9847074 1998 Toward a complete human genome sequence.
9516469 1998 Cloning of the multipartite promoter of the sodium-calcium exchanger gene NCX1 and characterization of its activity in vascular smooth muscle cells.
8921376 1996 The organization of the human gene NCX1 encoding the sodium-calcium exchanger.
8790037 1996 Evidence for functional relevance of an enhanced expression of the Na(+)-Ca2+ exchanger in failing human myocardium.
8485996 1993 Mapping of the human cardiac Na+/Ca2+ exchanger gene (NCX1) by fluorescent in situ hybridization to chromosome region 2p22-->p23.
8048567 1994 Functional expression of human renal Na+/Ca2+ exchanger in insect cells.
1647256 1991 Na+/Ca2+ exchange activity is increased in Alzheimer's disease brain tissues.
1559714 1992 Mapping of the gene for the cardiac sarcolemmal Na(+)-Ca2+ exchanger to human chromosome 2p21-p23.
1476165 1992 Expression of the Na-Ca exchanger in diverse tissues: a study using the cloned human cardiac Na-Ca exchanger.
1374913 1992 Molecular cloning and characterization of the human cardiac Na+/Ca2+ exchanger cDNA.