Property Summary

NCBI Gene PubMed Count 24
PubMed Score 15.77
PubTator Score 6.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.700 1.1e-06
osteosarcoma 2.038 1.4e-04
primitive neuroectodermal tumor -1.200 1.2e-04
Hydrolethalus syndrome -1.047 2.2e-02
colon cancer 1.100 6.9e-04
breast carcinoma 1.500 1.7e-04
Breast cancer 2.600 3.9e-02
group 3 medulloblastoma -1.500 1.3e-04
COPD -1.100 1.4e-02
ovarian cancer -1.200 6.7e-09
pituitary cancer -1.200 1.1e-03

Gene RIF (11)

PMID Text
26050671 LAT1 and LAT2 are present and functional in the syncytiotrophoblast MVM, whereas LAT2 is also expressed in the BM and in the fetal capillary endothelium.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
17558306 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17558306 Genetic variation in LAT1 and LAT2 does not appear to be a major cause of inter-individual variability in pharmacokinetics and of adverse reactions to melphalan.
15769744 identify LAT1 and LAT2 as members of system L that mediate transmembrane movement of l-CSNO
12716892 the interaction of CD98/LAT2 with ICAM-1, found to be expressed to the basolateral domain, and the potential of such interaction on intracellular signal activation in Caco2-BBE cell monolayers

AA Sequence

MEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAG      1 - 70
SVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIAL     71 - 140
TFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQIC    141 - 210
KGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVY    211 - 280
VFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHL    281 - 350
PSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPI    351 - 420
KINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFIELLTLVSQKM    421 - 490
CVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP                             491 - 535
//

Text Mined References (27)

PMID Year Title
26050671 2015 Expression and functional characterisation of System L amino acid transporters in the human term placenta.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
17558306 2007 Genetic polymorphisms in the amino acid transporters LAT1 and LAT2 in relation to the pharmacokinetics and side effects of melphalan.
16027961 2005 Expression of LAT1 and LAT2 amino acid transporters in human and rat intestinal epithelial cells.
15918515 2005 Reabsorption of neutral amino acids mediated by amino acid transporter LAT2 and TAT1 in the basolateral membrane of proximal tubule.
15901826 2005 Metabolic activation-related CD147-CD98 complex.
15769744 2005 Identification of stereoselective transporters for S-nitroso-L-cysteine: role of LAT1 and LAT2 in biological activity of S-nitrosothiols.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15081149 2004 Identification and functional characterization of a Na(+)-independent large neutral amino acid transporter (LAT2) on ARPE-19 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12716892 2003 CD98 and intracellular adhesion molecule I regulate the activity of amino acid transporter LAT-2 in polarized intestinal epithelia.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12117417 2002 Transport of a neurotoxicant by molecular mimicry: the methylmercury-L-cysteine complex is a substrate for human L-type large neutral amino acid transporter (LAT) 1 and LAT2.
11311135 2001 Association of 4F2hc with light chains LAT1, LAT2 or y+LAT2 requires different domains.
10610726 1999 SLC7A8, a gene mapping within the lysinuric protein intolerance critical region, encodes a new member of the glycoprotein-associated amino acid transporter family.
10574970 1999 LAT2, a new basolateral 4F2hc/CD98-associated amino acid transporter of kidney and intestine.
10391915 1999 Identification of a membrane protein, LAT-2, that Co-expresses with 4F2 heavy chain, an L-type amino acid transport activity with broad specificity for small and large zwitterionic amino acids.
10080183 1999 SLC7A7, encoding a putative permease-related protein, is mutated in patients with lysinuric protein intolerance.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.