Property Summary

NCBI Gene PubMed Count 17
PubMed Score 25.59
PubTator Score 10.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.100 2.8e-06
psoriasis -1.600 3.9e-04
osteosarcoma -1.250 9.3e-03
Amyotrophic Lateral Sclerosis 1.367 5.2e-09
acute quadriplegic myopathy 2.622 6.9e-08
colon cancer 1.200 6.1e-04
lung cancer 1.500 2.2e-03
Breast cancer 2.300 3.9e-02
interstitial cystitis 1.200 6.0e-04
atypical teratoid/rhabdoid tumor 1.100 1.8e-02

Gene RIF (5)

PMID Text
24142711 Results suggest that leukemia cell proliferation can be significantly suppressed by blocking amino acid transporter LAT3.
24052624 Inhibition of LAT transporters may provide a novel therapeutic target in metastatic castration-resistant prostate cancer, via suppression of mammalian target of rapamycin complex 1 activity and M-phase cell cycle genes.
23221699 L-theanine is transported mostly via the system L transport pathway and its isoforms
22007000 Data show that signaling via the androgen receptor and ATF4 pathways regulates expression of the amino acid transporters LAT1 and LAT3, thereby coordinating their increased expression in prostate cancer cells.
19443642 LAT3 may play a crucial role in the development and maintenance of podocyte structure and function by regulating protein synthesis and the actin cytoskeleton.

AA Sequence

MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGV      1 - 70
LVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQ     71 - 140
AIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMG    141 - 210
LVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTL    211 - 280
IYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREG    281 - 350
HLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPR    351 - 420
PLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRG    421 - 490
TQQLCFCVLTELDVAEEKKDERKTD                                                 491 - 515
//

Text Mined References (28)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24142711 2013 Suppression of amino acid transporter LAT3 expression on proliferation of K562 cells.
24052624 2013 Targeting amino acid transport in metastatic castration-resistant prostate cancer: effects on cell cycle, cell growth, and tumor development.
23221699 2012 The involvement of L-type amino acid transporters in theanine transport.
22007000 2011 Androgen receptor and nutrient signaling pathways coordinate the demand for increased amino acid transport during prostate cancer progression.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
19443642 2009 Amino acid transporter LAT3 is required for podocyte development and function.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17329401 2007 Activation of classical protein kinase C decreases transport via systems y+ and y+L.
17197568 2007 Ornithine transport via cationic amino acid transporter-1 is involved in ornithine cytotoxicity in retinal pigment epithelial cells.
16785209 Mutation of the 4F2 heavy-chain carboxy terminus causes y+ LAT2 light-chain dysfunction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15901826 2005 Metabolic activation-related CD147-CD98 complex.
15756301 2005 A y(+)LAT-1 mutant protein interferes with y(+)LAT-2 activity: implications for the molecular pathogenesis of lysinuric protein intolerance.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15280038 2004 INFgamma stimulates arginine transport through system y+L in human monocytes.
14603368 2003 Nitric oxide synthesis requires activity of the cationic and neutral amino acid transport system y+L in human umbilical vein endothelium.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11742806 2002 Two-way arginine transport in human endothelial cells: TNF-alpha stimulation is restricted to system y(+).
11311135 2001 Association of 4F2hc with light chains LAT1, LAT2 or y+LAT2 requires different domains.
11078698 2000 Arginine transport through system y(+)L in cultured human fibroblasts: normal phenotype of cells from LPI subjects.
10903140 2000 The heterodimeric amino acid transporter 4F2hc/y+LAT2 mediates arginine efflux in exchange with glutamine.
9878049 1999 Amino acid transport of y+L-type by heterodimers of 4F2hc/CD98 and members of the glycoprotein-associated amino acid transporter family.
9829974 1998 Identification and characterization of a membrane protein (y+L amino acid transporter-1) that associates with 4F2hc to encode the amino acid transport activity y+L. A candidate gene for lysinuric protein intolerance.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.