Property Summary

NCBI Gene PubMed Count 104
PubMed Score 135.56
PubTator Score 214.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 1.300 1.2e-05
psoriasis 2.000 2.1e-73
osteosarcoma -1.731 2.7e-02
cystic fibrosis -1.297 1.1e-05
non diabetic and post-ischemic heart fai... -1.100 1.1e-02
Atopic dermatitis 1.600 2.0e-04
tuberculosis -3.100 6.5e-06
non-small cell lung cancer 2.363 1.1e-18
lung cancer 3.900 1.1e-06
colon cancer 2.100 3.4e-07
lung adenocarcinoma 1.500 2.1e-10
non primary Sjogren syndrome sicca 1.200 1.6e-02
inflammatory breast cancer 2.300 5.0e-03
Polycystic Ovary Syndrome -1.138 4.8e-02
breast carcinoma 1.200 6.1e-17
ductal carcinoma in situ 2.400 1.2e-03
invasive ductal carcinoma 3.000 2.3e-04
ulcerative colitis 1.800 1.7e-05
ovarian cancer 1.400 1.8e-05
Gaucher disease type 3 1.200 4.8e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (83)

PMID Text
26944194 Proliferation of breast cancer cells is dependent on the expression of both LAT1 and AHR.
26621329 exposure to diesel exhaust particle extract induces functional overexpression of the amino acid transporter LAT1/CD98hc in lung cells
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
26437640 CD98 promotes cell spreading and tumorigenicity by triggering integrin clustering and enhancing cell adhesion to the extracellular matrix.
26256001 LAT1 is the transport competent unit of the LAT1/CD98 heterodimeric amino acid transporter.
26237765 LAT1 can serve as a significant prognostic factor to predict a poor outcome and it may therefore play an important role in the aggressiveness of cutaneous melanoma.
26054677 miR-126 plays a pivotal role in GC (gastric cancer) suppressing the process of GC cell, and this function is at least partly taken to implement by miR-126s's post-transcriptional effect on LAT-1.
26050671 LAT1 and LAT2 are present and functional in the syncytiotrophoblast MVM, whereas LAT2 is also expressed in the BM and in the fetal capillary endothelium.
25998567 LAPTM4b recruits LAT1-4F2hc to lysosomes, leading to uptake of leucine into lysosomes.
25979827 shRNA-mediated knockdown of Lat1 results in tumor growth inhibition and points to Lat1 as a potential therapeutic target.
25908107 These results suggest that LAT1 expression is associated with disease progression in gastric carcinoma.
25835180 Independently of Gleason score, aberrant overexpression of LAT1 in prostatic adenocarcinoma could predict LP under EM. Although prostate biopsy samples are small, LAT1 may be a novel prognostic biomarker of LP.
25701737 CAP-D3 down-regulates transcription of genes that encode amino acid transporters (SLC7A5 and SLC3A2) to promote bacterial autophagy by colon epithelial cells.
25597310 Metabolic changes accompanying activation of T cells must occur simultaneously with the reorganization of LAT1 and other transporters that are capable of providing sufficient nutrients to the cell. (Review)
25385314 data, therefore, suggest that FET is trapped within cells due to the asymmetry of its intra- and extracellular recognition by LAT1.
25220100 The study shows that the expression of LAT1 on myeloma cells is significantly associated with high proliferative activity as well as poor prognosis in patients with newly diagnosed multiple myeloma.
25089027 CD147 and CD98 might play important roles in cyclophilin-induced cell migration.
24890221 aberrant overexpression of LAT1 in bile duct adenocarcinoma predicts poor prognosis, suggesting that LAT1 may be a potential target of anticancer therapy.
24726839 LAT1 and its associated protein, 4F2hc, are up-regulated and miR-7 expression was regulated by LAT1.
24704384 Seven SNPs in SLC7A5 and 20 in SLC7A8 were genotyped. Multiple analyses indicated that 1 SNP in the first intron of SLC7A5, rs4240803, was significantly associated with TPN use.
24694899 L-type amino acid transporter 1 expression increases in well-differentiated but decreases in poorly differentiated endometrial endometrioid adenocarcinoma and shows an inverse correlation with p53 expression.
24606907 Polymorphisms of the LAT1 gene, there was no evidence for either allelic and/or genotypic association with the risk of NSCL/P in the Polish population.
24168110 Increased expression of system large amino acid transporter (LAT)-1 mRNA is associated with invasive potential and unfavorable prognosis of human clear cell renal cell carcinoma.
24131658 LAT1 expression was a significant independent predictor of biliary tract cancer survival by multivariate analysis.
23912240 The high yield expression of the human LAT1 transporter has been obtained for the first time using E. coli. The hLAT1 cDNA was amplified from HEK293 cells, cloned in pH6EX3 vector and expressed in E.coli.
23824658 LAT1 was expressed in gonad tissues and several kinds of cells having special functions, as well as being discovered to be an aspect of oncofetal protein.
23809372 LAT-1 may function as an oncogene in gastric cancer.
23696029 LAT1 is overexpressed in hepatocellular carcinoma and could serve as a potential prognostic marker.
23516127 Studied the clinicopathological significance of LAT1 expression in adenoid cystic carcinoma (ACC).
23270998 This study demonstrates that LAT1, primarily responsible for the uptake of large neutral amino acids, is functionally active in PC-3 cells.
23221699 L-theanine is transported mostly via the system L transport pathway and its isoforms
23103253 HIF-2alpha/mTORC1/SLC7A5 pathway mediates proliferation and tumor promoting properties of HIF-2alpha.
22813728 LAT1 aberrant overexpression in pancreatic ductal adenocarcinomas predicts poor prognosis, independent of Ki-67 LI, and offers a potential target for future anticancer therapy with its inhibitors.
22736142 The LAT1 promoter has a canonical c-Myc binding sequence and overexpression of c-Myc increased LAT1 promoter activity.
22199264 analysis of L-type amino acid transporter 1 (LAT1) expression in malignant pleural mesothelioma
22110199 High LAT1 expression is associated with drug resistance in non-small cell lung cancer.
22077314 study revealed that LAT1 and CD98 expression are positively correlated with breast cancer proliferation and negatively correlated with ER and PgR status; show that LAT1 and CD98 expression are prognostic factors in triple negative breast cancer
22007000 Data show that signaling via the androgen receptor and ATF4 pathways regulates expression of the amino acid transporters LAT1 and LAT3, thereby coordinating their increased expression in prostate cancer cells.
21798283 Variations in the ability of LAT1/DMT1/MTF1/MT1a to process and transport Hg may not play a significant role in the etiology of autism.
21530999 LAT1 expression decreases because of human papillomavirus infection as reflected by p16 overexpression in cervical intraepithelial neoplasia, whereas LAT1 expression in invasive carcinoma is associated with acquired malignant potential
21501294 LAT 1 expression may be linked with cell proliferation and prognosis of gastric carcinomas.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
21439283 Data shwo that SLC7A5 is a direct target of miR-126.
21371427 All these results indicate essential roles of LAT1 in the cell proliferation and occurrence of malignant phenotypes.
21055621 LAT1 expression is a stronger prognostic factor than (18)F-FAMT uptake in surgically resected non-small cell lung cancer
20680301 LAT1 mRNA was detectable only in fresh-frozen tissues of TSC, and it was upregulated in the cortical tuber lesion
20601542 LAT1 may have a critical and complex role in regulating human leiomyoma cell growth.
20510678 LAT1 increased expression in human ovarian cancer cell lines makes it a possible target for combination therapy with anti-proliferative aminopeptidase inhibitors.
20375792 upregulation of LAT1 is associated with ovarian cancer.
20374249 Host protein CD98 contributes to protection against enteropathogenic Escherichia coli-mediated cytotoxicity by interacion with bacterial sepZ protein.
20091333 High expression of LAT1 and increased L-methyl-11C-methionine uptake is associated with high-grade gliomas.
19777189 High LAT1 expression is associated with non-small-cell lung cancer with lymph node metastases.
19635099 Multivariate analysis confirmed that positive expression of LAT1 was an independent factor for predicting a poor prognosis in surgically resected stage I non-small cell lung cancer.
19559497 higher mRNA levels in non-small-cell lung carcinomas compared to normal lung tissues
19430419 the percentage of lung carcinoma patients remaining unclassifiable by TTF-1/TP63 was twice that of the five-antibody (TRIM29, CEACAM5, SLC7A5, MUC1, and CK5/6) test
19347882 LAT1 is frequently expressed in thymic carcinomas but is absent in thymomas
19184136 Observational study of gene-disease association. (HuGE Navigator)
19171406 over expression of Lat1 is a pathological factor to predict the prognosis in patients with resectable stage I pulmonary adenocarcinoma
19121087 elevated LAT1 expression in prostate cancers is a novel independent biomarker of high-grade malignancy
19068093 Elevated expression of CD98 is associated with squamous cell carcinoma of the lung.
19018776 LAT1 expression in primary and metastatic neoplasms is reported.
18813831 Inhibition of system L (LAT1/CD98hc) reduces the growth of cultured human breast cancer cells.
18440724 Expression of LAT1 tended to increase from low-grade to high-grade neuroendocrine tumors.
18382329 LAT1 may play an important role in enhancing the rates of tumor cell proliferation and growth in vivo.
18294274 Comparative immunohistochemical analyses of normal human tissues with anti-CD98 hc and anti-LAT1 revealed LAT1 to be an excellent molecular target for antibody therapy, possibly even superior to CD98 hc.
18262359 This study demonstrated that LAT1 is involved in 90% of total uptake of tyrosine and also around 51% of alanine. Not more than 10% can be accounted for by LAT2, LAT3 and LAT4 isoforms.
18253116 Overexpression of L-type amino acid transporter 1 is associated with nonsmall cell lung cancer
18095110 The expression of LAT1 was always higher in infiltrating glioma cells than in cells located in the center of the tumor.
17622555 expression of LAT1 protein and mRNA in 124 cases of transitional cell carcinoma of the upper urinary tract was examined; detection of the active form LAT1 protein appears to be of value in informing the risk of progression
17558306 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17558306 Genetic variation in LAT1 and LAT2 does not appear to be a major cause of inter-individual variability in pharmacokinetics and of adverse reactions to melphalan.
16496379 Findings suggest that LAT1 could be one of the molecular targets in glioma therapy.
16175382 LAT1 expression may increase with the upregulation of metabolic activity and cell proliferation in high-grade atypical adenomatous hyperplasia and bronchioloalveolar carcinoma.
15900591 In vivo efforts focusing on LAT1/CD98 as a potential therapeutic target in liver cells.
15769744 identify LAT1 and LAT2 as members of system L that mediate transmembrane movement of l-CSNO
15589117 studies demonstrate that the only known SNP in the open reading frame of human LAT1 has no effect on the kinetics of large neutral amino acid transport via this carrier
15200428 Differences in L-DOPA handling between SHR and WKY cells may result from over-expression of LAT1 and LAT2 transporters in the former.
15178563 Increased LAT1 expression can be induced by lipid oxidation products relevant to inflammatory responses in atherogenesis. LAT1 mediates lysophosphatidylcholine-enhanced cytokine production by endothelial cells.
12925876 study indicates the functional interaction between CD98 and CD147 in the regulation of cell fusion
12925876 The functional interaction between CD98 and CD147 is involved in the regulation of HIV-1 gp160-mediated cell fusion
9403839 The functional interaction between CD98 and CD147 is involved in the regulation of HIV-1 gp160-mediated cell fusion
8922468 The functional interaction between CD98 and CD147 is involved in the regulation of HIV-1 gp160-mediated cell fusion
7561057 The functional interaction between CD98 and CD147 is involved in the regulation of HIV-1 gp160-mediated cell fusion

AA Sequence

MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFV      1 - 70
TPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLII     71 - 140
RPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALAL    141 - 210
IILLGFVQIGKGDVSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIII    211 - 280
SLPIVTLVYVLTNLAYFTTLSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLF    281 - 350
FVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRH    351 - 420
RKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIF    421 - 490
STTVLCQKLMQVVPQET                                                         491 - 507
//

Text Mined References (118)

PMID Year Title
26944194 2016 Aryl hydrocarbon receptor (AHR) regulation of L-Type Amino Acid Transporter 1 (LAT-1) expression in MCF-7 and MDA-MB-231 breast cancer cells.
26621329 2016 Aryl hydrocarbon receptor-dependent up-regulation of the heterodimeric amino acid transporter LAT1 (SLC7A5)/CD98hc (SLC3A2) by diesel exhaust particle extract in human bronchial epithelial cells.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
26437640 2015 Basigin-mediated redistribution of CD98 promotes cell spreading and tumorigenicity in hepatocellular carcinoma.
26256001 2015 LAT1 is the transport competent unit of the LAT1/CD98 heterodimeric amino acid transporter.
26237765 2015 Prognostic significance of L-type amino acid transporter 1 (LAT1) expression in cutaneous melanoma.
26054677 2015 MicroRNA-126 inhibits cell proliferation in gastric cancer by targeting LAT-1.
26050671 2015 Expression and functional characterisation of System L amino acid transporters in the human term placenta.
25998567 2015 LAPTM4b recruits the LAT1-4F2hc Leu transporter to lysosomes and promotes mTORC1 activation.
25979827 2015 Reciprocal regulation of amino acid import and epigenetic state through Lat1 and EZH2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25908107 2015 L-Type amino acid transporter 1 (LAT1) expression in lymph node metastasis of gastric carcinoma: Its correlation with size of metastatic lesion and Ki-67 labeling.
25835180 2015 L-amino acid transporter 1 may be a prognostic marker for local progression of prostatic cancer under expectant management.
25701737 2015 Chromosome-associated protein D3 promotes bacterial clearance in human intestinal epithelial cells by repressing expression of amino acid transporters.
25597310 2014 Role of LAT1 in the promotion of amino acid incorporation in activated T cells.
25385314 2015 System L amino acid transporter LAT1 accumulates O-(2-fluoroethyl)-L-tyrosine (FET).
25220100 2014 Expression of L-type amino acid transporter 1 (LAT1) as a prognostic and therapeutic indicator in multiple myeloma.
25089027 2015 CD147 and CD98 complex-mediated homotypic aggregation attenuates the CypA-induced chemotactic effect on Jurkat T cells.
24890221 2014 High expression of L-type amino acid transporter 1 as a prognostic marker in bile duct adenocarcinomas.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24726839 2014 Downregulation of LAT1 expression suppresses cholangiocarcinoma cell invasion and migration.
24704384 2014 A single nucleotide polymorphism in SLC7A5 is associated with gastrointestinal toxicity after high-dose melphalan and autologous stem cell transplantation for multiple myeloma.
24694899 2014 L-type amino acid transporter 1 expression increases in well-differentiated but decreases in poorly differentiated endometrial endometrioid adenocarcinoma and shows an inverse correlation with p53 expression.
24606907 2014 Association of common variants in PAH and LAT1 with non-syndromic cleft lip with or without cleft palate (NSCL/P) in the Polish population.
24168110 2013 Increased expression of system large amino acid transporter (LAT)-1 mRNA is associated with invasive potential and unfavorable prognosis of human clear cell renal cell carcinoma.
24131658 2013 Clinical significance of L-type amino acid transporter 1 expression as a prognostic marker and potential of new targeting therapy in biliary tract cancer.
23912240 2013 Cloning, large scale over-expression in E. coli and purification of the components of the human LAT 1 (SLC7A5) amino acid transporter.
23824658 2014 Unique and selective expression of L-amino acid transporter 1 in human tissue as well as being an aspect of oncofetal protein.
23809372 2013 LAT-1 functions as a promotor in gastric cancer associated with clinicopathologic features.
23696029 2013 The impact of L-type amino acid transporter 1 (LAT1) in human hepatocellular carcinoma.
23516127 2013 Clinicopathological significance of L-type amino acid transporter 1 (LAT1) expression in patients with adenoid cystic carcinoma.
23270998 2013 Functional characterization and molecular expression of large neutral amino acid transporter (LAT1) in human prostate cancer cells.
23221699 2012 The involvement of L-type amino acid transporters in theanine transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23103253 2012 HIF2? acts as an mTORC1 activator through the amino acid carrier SLC7A5.
22813728 2012 High expression of L-type amino acid transporter 1 (LAT1) predicts poor prognosis in pancreatic ductal adenocarcinomas.
22736142 2012 c-Myc is crucial for the expression of LAT1 in MIA Paca-2 human pancreatic cancer cells.
22199264 2011 L-type amino acid transporter 1 (LAT1) expression in malignant pleural mesothelioma.
22110199 2011 Relationship between LAT1 expression and response to platinum-based chemotherapy in non-small cell lung cancer patients with postoperative recurrence.
22077314 2012 Correlation of L-type amino acid transporter 1 and CD98 expression with triple negative breast cancer prognosis.
22007000 2011 Androgen receptor and nutrient signaling pathways coordinate the demand for increased amino acid transport during prostate cancer progression.
21798283 2011 Lack of association between autism and four heavy metal regulatory genes.
21530999 2011 Divergent expression of L-type amino acid transporter 1 during uterine cervical carcinogenesis.
21501294 2011 High expression of L-type amino-acid transporter 1 (LAT1) in gastric carcinomas: comparison with non-cancerous lesions.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
21439283 2011 miR-126 inhibits proliferation of small cell lung cancer cells by targeting SLC7A5.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21371427 2011 Oncogenicity of L-type amino-acid transporter 1 (LAT1) revealed by targeted gene disruption in chicken DT40 cells: LAT1 is a promising molecular target for human cancer therapy.
21269460 2011 Initial characterization of the human central proteome.
21055621 2010 Comparison of L-type amino acid transporter 1 expression and L-[3-18F]-?-methyl tyrosine uptake in outcome of non-small cell lung cancer.
20680301 2011 Increased expression of L-amino acid transporters in balloon cells of tuberous sclerosis.
20601542 2010 LAT1 regulates growth of uterine leiomyoma smooth muscle cells.
20510678 2010 Impact of system L amino acid transporter 1 (LAT1) on proliferation of human ovarian cancer cells: a possible target for combination therapy with anti-proliferative aminopeptidase inhibitors.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20375792 2010 Properties of L-type amino acid transporter 1 in epidermal ovarian cancer.
20374249 2010 The pathogenic E. coli type III effector EspZ interacts with host CD98 and facilitates host cell prosurvival signalling.
20091333 2010 Correlation of L-methyl-11C-methionine (MET) uptake with L-type amino acid transporter 1 in human gliomas.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19777189 2009 CD98 expression is associated with poor prognosis in resected non-small-cell lung cancer with lymph node metastases.
19635099 2009 L-type amino acid transporter 1 expression is a prognostic marker in patients with surgically resected stage I non-small cell lung cancer.
19559497 2010 LAT1 expression in non-small-cell lung carcinomas: analyses by semiquantitative reverse transcription-PCR (237 cases) and immunohistochemistry (295 cases).
19430419 2009 A novel five-antibody immunohistochemical test for subclassification of lung carcinoma.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19347882 2009 L-type amino acid transporter 1 (LAT1) is frequently expressed in thymic carcinomas but is absent in thymomas.
19184136 2009 Examination of association of genes in the serotonin system to autism.
19171406 2009 Prognostic significance of L-type amino acid transporter 1 (LAT1) and 4F2 heavy chain (CD98) expression in stage I pulmonary adenocarcinoma.
19121087 2009 L-type amino-acid transporter 1 as a novel biomarker for high-grade malignancy in prostate cancer.
19068093 2009 Prognostic significance of L-type amino acid transporter 1 (LAT1) and 4F2 heavy chain (CD98) expression in early stage squamous cell carcinoma of the lung.
19018776 2008 l-type amino acid transporter 1 and CD98 expression in primary and metastatic sites of human neoplasms.
18813831 2008 Inhibition of system L (LAT1/CD98hc) reduces the growth of cultured human breast cancer cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18440724 2008 Expression of L-type amino acid transporter 1 (LAT1) in neuroendocrine tumors of the lung.
18382329 2008 Enhanced tumor growth elicited by L-type amino acid transporter 1 in human malignant glioma cells.
18294274 2008 Production and characterization of highly tumor-specific rat monoclonal antibodies recognizing the extracellular domain of human L-type amino-acid transporter 1.
18262359 2008 Functional characterization of tyrosine transport in fibroblast cells from healthy controls.
18253116 2008 Prognostic significance of L-type amino acid transporter 1 expression in resectable stage I-III nonsmall cell lung cancer.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
18095110 2005 High expression of L-type amino acid transporter 1 in infiltrating glioma cells.
17622555 2007 Expression of LAT1 predicts risk of progression of transitional cell carcinoma of the upper urinary tract.
17558306 2007 Genetic polymorphisms in the amino acid transporters LAT1 and LAT2 in relation to the pharmacokinetics and side effects of melphalan.
16496379 2006 L-type amino acid transporter 1 as a potential molecular target in human astrocytic tumors.
16175382 2006 LAT1 expression in normal lung and in atypical adenomatous hyperplasia and adenocarcinoma of the lung.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
16027961 2005 Expression of LAT1 and LAT2 amino acid transporters in human and rat intestinal epithelial cells.
15901826 2005 Metabolic activation-related CD147-CD98 complex.
15900591 2005 Adenoviral modulation of the tumor-associated system L amino acid transporter, LAT1, alters amino acid transport, cell growth and 4F2/CD98 expressionwith cell-type specific effects in cultured hepatic cells.
15769744 2005 Identification of stereoselective transporters for S-nitroso-L-cysteine: role of LAT1 and LAT2 in biological activity of S-nitrosothiols.
15589117 2004 Human LAT1 single nucleotide polymorphism N230K does not alter phenylalanine transport.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15200428 2004 Over-expression of renal LAT1 and LAT2 and enhanced L-DOPA uptake in SHR immortalized renal proximal tubular cells.
15178563 2004 Lysophosphatidylcholine enhances cytokine production of endothelial cells via induction of L-type amino acid transporter 1 and cell surface antigen 4F2.
12925876 2004 The functional interaction between CD98 and CD147 in regulation of virus-induced cell fusion and osteoclast formation.
12824232 2003 Identification and functional characterization of a Na+-independent large neutral amino acid transporter, LAT1, in human and rabbit cornea.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12225859 2002 Characterization of the system L amino acid transporter in T24 human bladder carcinoma cells.
12117417 2002 Transport of a neurotoxicant by molecular mimicry: the methylmercury-L-cysteine complex is a substrate for human L-type large neutral amino acid transporter (LAT) 1 and LAT2.
12009310 2002 Up-regulated expression of a novel gene in activated human peripheral blood mononuclear cells that is a truncated paralog of the human system L-amino acid transporter 1.
11742812 2002 Expression and regulation of 4F2hc and hLAT1 in human trophoblasts.
11564694 2001 Thyroid hormone transport by the heterodimeric human system L amino acid transporter.
11557028 2001 Human L-type amino acid transporter 1 (LAT1): characterization of function and expression in tumor cell lines.
11535130 2001 Molecular events involved in up-regulating human Na+-independent neutral amino acid transporter LAT1 during T-cell activation.
11389679 2001 Role of the System L permease LAT1 in amino acid and iodothyronine transport in placenta.
11311135 2001 Association of 4F2hc with light chains LAT1, LAT2 or y+LAT2 requires different domains.
11095508 2000 Expression of a system L neutral amino acid transporter at the blood-brain barrier.
10629848 1999 [Amino acid transporter molecule as a drug target].
10574970 1999 LAT2, a new basolateral 4F2hc/CD98-associated amino acid transporter of kidney and intestine.
10568788 1999 New glycoprotein-associated amino acid transporters.
10391915 1999 Identification of a membrane protein, LAT-2, that Co-expresses with 4F2 heavy chain, an L-type amino acid transport activity with broad specificity for small and large zwitterionic amino acids.
10072483 1999 Cutting edge: primary structure of the light chain of fusion regulatory protein-1/CD98/4F2 predicts a protein with multiple transmembrane domains that is almost identical to the amino acid transporter E16.
10049700 1999 Human LAT1, a subunit of system L amino acid transporter: molecular cloning and transport function.
9878049 1999 Amino acid transport of y+L-type by heterodimers of 4F2hc/CD98 and members of the glycoprotein-associated amino acid transporter family.
9829974 1998 Identification and characterization of a membrane protein (y+L amino acid transporter-1) that associates with 4F2hc to encode the amino acid transport activity y+L. A candidate gene for lysinuric protein intolerance.
9751058 1998 Amino-acid transport by heterodimers of 4F2hc/CD98 and members of a permease family.
7829099 1994 The gene for membrane protein E16 (D16S469E) maps to human chromosome 16q24.3 and is expressed in human brain, thymus, and retina.
1597461 1992 A novel transiently expressed, integral membrane protein linked to cell activation. Molecular cloning via the rapid degradation signal AUUUA.