Property Summary

NCBI Gene PubMed Count 12
PubMed Score 140.10
PubTator Score 31.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
primitive neuroectodermal tumor 1.400 9.1e-03
atypical teratoid/rhabdoid tumor 1.400 1.5e-02
group 4 medulloblastoma 1.200 4.9e-03
invasive ductal carcinoma -2.295 4.3e-04
Breast cancer -1.100 1.2e-51
psoriasis -1.200 3.9e-07

Gene RIF (5)

PMID Text
26215737 rare hypomorphic variants of SLC7A3 exist in male individuals, SLC7A3 variants possibly contribute to the etiology of autism spectrum disorders in male subjects in association with other genetic factors
25130427 knockdown impaired AMPK-PPAR-alpha signaling and resulted in lipid accumulation under glucose starvation in liver cells
22870827 CAT1, CAT2, and CAT3 localized in adult brains but with uneven distribution.
16332251 It is concluded that similar to hCAT-1, hCAT-3 activity is decreased by PKC via reduction of transporter molecules in the plasma membrane.
15737334 is concluded that hCAT-3 is a passive transport system that conducts monovalent cations including L-Arg.

AA Sequence

MPWQAFRRFGQKLVRRRTLESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICF      1 - 70
LVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLI     71 - 140
GNHISKTLQGSIALHVPHVLAEYPDFFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGFV    141 - 210
KGDVHNWKLTEEDYELAMAELNDTYSLGPLGSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNP    211 - 280
QRSIPMGIVISLSVCFLAYFAVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLL    281 - 350
GSMFPMPRVIYAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSL    351 - 420
VSICVLILRYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQIVYVCSSLLAVLLTA    421 - 490
LCLVLAQWSVPLLSGDLLWTAVVVLLLLLIIGIIVVIWRQPQSSTPLHFKVPALPLLPLMSIFVNIYLMM    491 - 560
QMTAGTWARFGVWMLIGFAIYFGYGIQHSLEEIKSNQPSRKSRAKTVDLDPGTLYVHSV               561 - 619
//

Text Mined References (15)

PMID Year Title
26215737 2015 Hypomorphic variants of cationic amino acid transporter 3 in males with autism spectrum disorders.
25130427 2014 Genetic ablation of solute carrier family 7a3a leads to hepatic steatosis in zebrafish during fasting.
22870827 2013 Differential topochemistry of three cationic amino acid transporter proteins, hCAT1, hCAT2 and hCAT3, in the adult human brain.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16332251 2006 Activation of classical protein kinase C reduces the expression of human cationic amino acid transporter 3 (hCAT-3) in the plasma membrane.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15772651 2005 The DNA sequence of the human X chromosome.
15737334 2005 Monovalent cation conductance in Xenopus laevis oocytes expressing hCAT-3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591158 2001 Human cationic amino acid transporter hCAT-3 is preferentially expressed in peripheral tissues.