Property Summary

Ligand Count 13
NCBI Gene PubMed Count 63
PubMed Score 430.05
PubTator Score 185.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Dermatitis, Contact 71 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Disease Target Count
Contact Dermatitis 81
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 0.8
Disease Target Count Z-score Confidence
Dyscalculia 5 4.068 2.0
Cancer 2499 4.036 2.0
Spondylolysis 14 3.157 1.6
Cystinuria 18 3.016 1.5

Expression

  Differential Expression (29)

Protein-protein Interaction (1)

Gene RIF (49)

AA Sequence

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVL      1 - 70
QNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATA     71 - 140
VISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGV    141 - 210
MQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIG    211 - 280
YVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGH    281 - 350
LPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP    351 - 420
FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQI    421 - 490
ILEVVPEEDKL                                                               491 - 501
//

Text Mined References (67)

PMID Year Title