Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.83
PubTator Score 35.24

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 3.000 3.0e-08
posterior fossa group A ependymoma -2.000 2.5e-14
glioblastoma -1.600 8.0e-04
group 4 medulloblastoma -2.100 4.8e-07
atypical teratoid / rhabdoid tumor -1.700 2.3e-08
medulloblastoma, large-cell -1.900 5.1e-06
pediatric high grade glioma -1.700 3.5e-05
pilocytic astrocytoma -1.600 1.5e-06
ductal carcinoma in situ -2.900 1.2e-04
invasive ductal carcinoma -2.600 3.8e-03

Gene RIF (4)

25219498 ASC1 is a target for ufmylation and that UFBP1 is an essential component for ASC1 ufmylation.
25080478 The amino acid transporter ASC-1 is a white adipocyte-specific cell surface protein.
21888942 In conclusion, SLC7A10 had no apparent degree of association with schizophrenia as a candidate susceptibility gene in the disease per se.
15458438 The lack of expression of asc-1 in the proximal tubule indicates that it plays no role in the bulk of renal reabsorption of amino acids

AA Sequence

CFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ                                         491 - 523

Text Mined References (14)

PMID Year Title
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
25080478 2014 ASC-1, PAT2, and P2RX5 are cell surface markers for white, beige, and brown adipocytes.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21888942 2011 No genetic association between SLC7A10 and Japanese patients with schizophrenia.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
15901826 2005 Metabolic activation-related CD147-CD98 complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15458438 2004 The amino acid transporter asc-1 is not involved in cystinuria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11509015 2001 Is the SLC7A10 gene on chromosome 19 a candidate locus for cystinuria?
11441184 2001 Human chromosome 19 and related regions in mouse: conservative and lineage-specific evolution.
10863037 2000 Cloning and characterization of a human brain Na(+)-independent transporter for small neutral amino acids that transports D-serine with high affinity.
10734121 2000 Identification and characterization of a Na(+)-independent neutral amino acid transporter that associates with the 4F2 heavy chain and exhibits substrate selectivity for small neutral D- and L-amino acids.