Property Summary

NCBI Gene PubMed Count 29
PubMed Score 9.43
PubTator Score 153.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 1.0e-02
ependymoma 1.500 4.2e-03
oligodendroglioma 1.300 3.6e-03
cutaneous lupus erythematosus -1.200 2.8e-03
psoriasis -1.200 3.9e-03
glioblastoma 1.700 5.5e-03
pediatric high grade glioma 1.300 5.1e-03
Polycystic Ovary Syndrome -1.035 1.2e-02
mucosa-associated lymphoid tissue lympho... 1.150 3.8e-02

Gene RIF (19)

PMID Text
26302655 Study found that temporal lobe epilepsy is associated with increased levels of GlyT1
23132267 Following biopterin administration, glycine transporter type I occupancy correlates with biopterin plasma concentration.
22705056 The increased sensitivity of human GlyT1c to sanguinarine is abolished by the mutation of only cysteine 475.
22425803 Synaptic and extrasynaptic concentrations of glycine are regulated by its type-1 glycine transporter, which is primarily expressed in astroglial and glutamatergic cell membranes.
21688322 Human positron-emission tomography studies determine the test-retest reproducibility of [11C]GSK931145, a ligand which readily enters the brain, displaying a heterogeneous uptake which corresponds well with the known distribution of GlyT-1.
21628872 metabolic functions of GLYT1 in intestine: metabolism/regulation of glycine/glutathione; role in response to physiological stress (e.g., oxidative stress); possible role in pathophysiology/therapy of inflammatory bowel diseases [REVIEW]
19650813 Observational study of gene-disease association. (HuGE Navigator)
19556729 association between SLC6A9 SNPs and essential hypertension in a Japanese population, suggesting that SLC6A9 is a susceptibility locus for essential hypertension.
19556729 Observational study of gene-disease association. (HuGE Navigator)
19427831 the results suggest that GLYT1 and membrane rafts are co-localized in the membrane, and that this influences the rate of glycine transport.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18638388 SLC6A9 gene is associated with schizophrenia.
18638388 Observational study of gene-disease association. (HuGE Navigator)
18411704 Single nucleotide polymorphism or haplotype of the gene produce risks for susceptibility to drug dependence.
17582620 Genetic variation of the glycine transporter 1 gene may contribute to individual vulnerability to methamphetamine dependence and psychosis.
17582620 Observational study of gene-disease association. (HuGE Navigator)
16841561 Observational study of gene-disease association. (HuGE Navigator)
16604304 Observational study of gene-disease association. (HuGE Navigator)
16121932 The mechanism of allosteric interaction of cytoplasmic and extracellular Cl- in the glial glycine transporter (hGlyTlb).

AA Sequence

MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLL      1 - 70
PQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMF     71 - 140
PYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSS    141 - 210
MTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDI    211 - 280
GNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTP    281 - 350
QWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF    351 - 420
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGN    421 - 490
EWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDI    491 - 560
QMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMF    561 - 630
RLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSR    631 - 700
LQDSRI                                                                    701 - 706
//

Text Mined References (31)

PMID Year Title
26302655 2015 Glycine transporter 1 is a target for the treatment of epilepsy.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23132267 2013 Glycine transporter type 1 occupancy by bitopertin: a positron emission tomography study in healthy volunteers.
22705056 2012 Molecular basis for differential glycine transporters sensitivity to sanguinarine.
22425803 2012 Interactions between glycine transporter type 1 (GlyT-1) and some inhibitor molecules - glycine transporter type 1 and its inhibitors (review).
21688322 2011 Translational characterization of [11C]GSK931145, a PET ligand for the glycine transporter type 1.
21628872 2011 The glycine transporter GLYT1 in human intestine: expression and function.
19650813 2009 No association of alcohol dependence with SLC6A5 and SLC6A9 glycine transporter polymorphisms.
19556729 2009 Association of SLC6A9 gene variants with human essential hypertension.
19427831 2009 Glycine transporter 1 associates with cholesterol-rich membrane raft microdomains.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18638388 2008 Association study of polymorphisms in the neutral amino acid transporter genes SLC1A4, SLC1A5 and the glycine transporter genes SLC6A5, SLC6A9 with schizophrenia.
18411704 2008 [Potential genetic predictors for individual vulnerability to substance dependence].
17582620 2008 The glycine transporter 1 gene (GLYT1) is associated with methamphetamine-use disorder.
16841561 2006 Polymorphisms in glycine transporter with schizophrenia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16604304 2006 Association study of polymorphisms in glycine transporter with schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16121932 The mechanism of allosteric interaction of cytoplasmic and extracellular Cl- in the glial glycine transporter (hGlyTlb).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12091465 2002 Glycine transporter isoforms show differential subcellular localization in PC12 cells.
11360303 2001 Glyt-1 expression in cultured human Müller cells and intact retinae.
11159884 2001 Glycine supply to human enterocytes mediated by high-affinity basolateral GLYT1.
10722844 2000 Characterization of the interactions between the glycine transporters GLYT1 and GLYT2 and the SNARE protein syntaxin 1A.
10625616 2000 GABA receptor rho1 subunit interacts with a novel splice variant of the glycine transporter, GLYT-1.
10606742 1999 Cloning, functional characterisation and population analysis of a variant form of the human glycine type 2 transporter.
8494645 1993 Two glycine transporter variants with distinct localization in the CNS and peripheral tissues are encoded by a common gene.
8183239 1994 Cloning of the human glycine transporter type 1: molecular and pharmacological characterization of novel isoform variants and chromosomal localization of the gene in the human and mouse genomes.
7721869 1995 The role of N-glycosylation in the targeting and activity of the GLYT1 glycine transporter.
7587377 1995 Assignment of SLC6A9 to human chromosome band 1p33 by in situ hybridization.