Property Summary

NCBI Gene PubMed Count 45
PubMed Score 269.97
PubTator Score 94.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
gastric cancer -1.200 3.3e-02
malignant mesothelioma 1.100 2.4e-05
posterior fossa group B ependymoma -1.900 9.0e-08
oligodendroglioma -1.100 2.7e-02
psoriasis -1.600 1.0e-03
osteosarcoma -1.355 2.8e-03
atypical teratoid / rhabdoid tumor 1.400 1.6e-04
group 4 medulloblastoma 1.600 4.1e-03
medulloblastoma, large-cell 2.100 9.1e-05
acute quadriplegic myopathy 1.655 4.2e-05
adrenocortical carcinoma -1.453 4.3e-04
primary pancreatic ductal adenocarcinoma 3.378 5.5e-04
tuberculosis and treatment for 3 months -1.100 3.6e-04
intraductal papillary-mucinous neoplasm ... 2.600 4.7e-02
colon cancer 3.300 1.4e-02
lung cancer 1.200 1.4e-02
active Crohn's disease 1.355 1.0e-03
ulcerative colitis 2.800 8.6e-07
pancreatic cancer 3.200 6.5e-03
interstitial cystitis 1.700 1.0e-04
invasive ductal carcinoma 2.116 5.2e-04
nasopharyngeal carcinoma -1.100 1.8e-03
COPD -1.500 2.0e-03
lung carcinoma -2.700 6.9e-34
ductal carcinoma in situ 1.200 7.4e-04
ovarian cancer -1.900 1.7e-05
Gaucher disease type 3 -1.300 7.8e-03

Gene RIF (24)

PMID Text
26206726 CNDP1 and CARNS are expressed in glomeruli and tubular cells; TauT is expressed in renal epithelial cells; CDNP1 may have a role in diabetic neuropathy
25501278 This is the first study to present information on the transcriptional regulation of taurine transporter gene and the localization of the taurine transporter protein in chondrocytic cells.
24866236 Immunocytochemistry and flow cytometry analyses revealed that these mAbs recognized the native form of the extracellular domain of SLC6A6 on the cell surface.
24842606 Neurotransmitter transporters including SLC6A6 and SLC6A13 mediate the uptake of 5-aminolevulinic acid (ALA) and can play roles in the enhancement of ALA-induced accumulation of protoporphyrin in cancerous cells.
23519128 Taurine transporter deficiency results in aberrant trophoblast turnover and fetal growth restriction.
23392892 Knockdown of TauT impairs kidney development, possibly through regulation of cell cycle-related genes.
23392891 Expression of TauT is differentially regulated by Vitamin D(3) and retinoic acid via formation of VDR and RXR complexes in the nuclei in a cell type-dependent manner.
23392873 Syncytiotrophoblast TauT activity is reduced in maternal obesity and pre-eclampsia compared to normal pregnancy.
23180277 Taurine transporter is a novel pathological marker for stressed motor neurons in amyotrophic lateral sclerosis.
21739148 TauT gene is overexpressed in peripheral blood mononuclear cells of type 2 diabetic patients.
20424473 Observational study of gene-disease association. (HuGE Navigator)
19602579 Glucose reduced taurine transporter (TauT) mRNA and protein in a dose-dependent manner.
19423693 critical role in protecting against cisplatin-induced nephrotoxicity, possibly by attenuating a p53-dependent pathway
19074966 This study demonstrates the functional coexpression of TauT along with the PAT1 transporter (SLC36A1) at the apical membrane of the intestinal epithelium.
18703994 Report taurine transporter activity in fetal T lymphocytes in intrauterine growth restriction and with tumor necrosis factor-alpha treatment.
16956961 Greater system beta activity in fetal platelets compared with T lymphocytes is the result of relatively greater TAUT mRNA and protein expression.
16356117 taurine cotransporter is regulated by oxidative stress and overexpression of aldose reductase and high glucose impair this response
15907840 reporter assay revealed that TNF-alpha-induced TAUT transcriptional activity through the NF-kappaB consensus-like sequence in the human TAUT promoter region
15630186 TAUT activity in TNF-alpha-treated Caco-2 cells suggests that up-regulation was associated with an increase in the amount of TAUT.
15225620 The increased expression level of TAUT mRNA by hypertonicity was repressed by the specific Ca(2+)/CaM kinase II inhibitor.
15166008 nitric oxide plays an important role in downregulating microvillous plasma membrane taurine transporter activity in intrauterine growth restriction
12681485 regulation by WT1
12163498 TauT is involved with p53 in renal development and apoptosis.
12062416 TNF-alpha-treated cells showed a higher mRNA level of the TAUT (taurine transporter) than did the control cells.

AA Sequence

MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYL      1 - 70
CYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLFSGIGYASVVIVSLLNVYYIV     71 - 140
ILAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGI    141 - 210
DHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYP    211 - 280
DITRLEDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGF    281 - 350
MAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPS    351 - 420
FLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIAWIYGGDNLYD    421 - 490
GIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTYNKTYVYPNWAIGLGWSLALSSMLCVPLV    491 - 560
IVIRLCQTEGPFLVRVKYLLTPREPNRWAVEREGATPYNSRTVMNGALVKPTHIIVETMM              561 - 620
//

Text Mined References (48)

PMID Year Title
26206726 2015 Intrinsic carnosine metabolism in the human kidney.
25501278 2015 Chondrocytic cells express the taurine transporter on their plasma membrane and regulate its expression under anisotonic conditions.
24866236 2014 Immunization method for multi-pass membrane proteins using highly metastatic cell lines.
24842606 Neurotransmitter transporter family including SLC6A6 and SLC6A13 contributes to the 5-aminolevulinic acid (ALA)-induced accumulation of protoporphyrin IX and photodamage, through uptake of ALA by cancerous cells.
23519128 2013 Taurine transport in human placental trophoblast is important for regulation of cell differentiation and survival.
23392892 2013 Knockdown of TauT expression impairs human embryonic kidney 293 cell development.
23392891 2013 Differential regulation of TauT by calcitriol and retinoic acid via VDR/RXR in LLC-PK1 and MCF-7 cells.
23392873 2013 Reduced placental taurine transporter (TauT) activity in pregnancies complicated by pre-eclampsia and maternal obesity.
23180277 2013 Expression of taurine transporter (TauT) is modulated by heat shock factor 1 (HSF1) in motor neurons of ALS.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
21739148 2012 Taurine transporter gene expression in peripheral mononuclear blood cells of type 2 diabetic patients.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19602579 2009 Oxidative stress and dysregulation of the taurine transporter in high-glucose-exposed human Schwann cells: implications for pathogenesis of diabetic neuropathy.
19423693 2009 Functional TauT protects against acute kidney injury.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19074966 2009 Taurine uptake across the human intestinal brush-border membrane is via two transporters: H+-coupled PAT1 (SLC36A1) and Na+- and Cl(-)-dependent TauT (SLC6A6).
18703994 2009 Amino acid transport systems beta and A in fetal T lymphocytes in intrauterine growth restriction and with tumor necrosis factor-alpha treatment.
18501699 2008 Function of taurine transporter (Slc6a6/TauT) as a GABA transporting protein and its relevance to GABA transport in rat retinal capillary endothelial cells.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
17153592 2006 TauT gene expression is regulated by TonEBP and plays a role in cell survival.
17153588 2006 Osmosensitive gene expression of taurine transporter and cyclin C in embryonic fibroblast cells.
16956961 2007 Taurine transporter in fetal T lymphocytes and platelets: differential expression and functional activity.
16729199 2006 Taurine transporter is expressed in osteoblasts.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16356117 Regulation of the human taurine transporter by oxidative stress in retinal pigment epithelial cells stably transformed to overexpress aldose reductase.
15907840 2005 Signaling pathways involved in tumor necrosis factor alpha-induced upregulation of the taurine transporter in Caco-2 cells.
15701671 2005 Influence of standard haemodialysis treatment on transcription of human serum- and glucocorticoid-inducible kinase SGK1 and taurine transporter TAUT in blood leukocytes.
15630186 2004 Regulation of the human taurine transporter by TNF-alpha and an anti-inflammatory function of taurine in human intestinal Caco-2 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225620 2004 Activation of Ca2+/calmodulin-dependent protein kinase II is involved in hyperosmotic induction of the human taurine transporter.
15166008 2004 Human placental taurine transporter in uncomplicated and IUGR pregnancies: cellular localization, protein expression, and regulation.
15142033 2004 Expression of taurine transporter is regulated through the TonE (tonicity-responsive element)/TonEBP (TonE-binding protein) pathway and contributes to cytoprotection in HepG2 cells.
12908598 2003 Characterization of transcriptional activity of taurine transporter using luciferase reporter constructs.
12908596 2003 Finding of TRE (TPA responsive element) in the sequence of human taurine transporter promoter.
12908594 2003 Transactivation of TauT by p53 in MCF-7 cells: the role of estrogen receptors.
12871209 2003 Functional characterization and regulation of the taurine transporter and cysteine dioxygenase in human hepatoblastoma HepG2 cells.
12681485 2003 Regulation of taurine transporter gene (TauT) by WT1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163498 2002 Transcriptional repression of taurine transporter gene (TauT) by p53 in renal cells.
11140363 2000 Physiological significance of taurine and the taurine transporter in intestinal epithelial cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8654117 1996 Isolation of a cDNA encoding a taurine transporter in the human retinal pigment epithelium.
8382624 1993 Cloning of the human taurine transporter and characterization of taurine uptake in thyroid cells.
8010975 1994 Functional characterization and chromosomal localization of a cloned taurine transporter from human placenta.
7881434 1994 Dinucleotide repeat polymorphism in the human taurine transporter gene (TAUT).
7774940 1995 Mapping of the taurine transporter gene to mouse chromosome 6 and to the short arm of human chromosome 3.
1518851 1992 Molecular cloning of the cDNA for an MDCK cell Na(+)- and Cl(-)-dependent taurine transporter that is regulated by hypertonicity.