Property Summary

NCBI Gene PubMed Count 702
PubMed Score 3495.06
PubTator Score 2895.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
osteosarcoma 7933 9.4e-06
group 4 medulloblastoma 1875 1.2e-04
malignant mesothelioma 3163 3.3e-04
diabetes mellitus 1663 1.3e-03
Disease Target Count Z-score Confidence
Dystonia 77 0.0 4.0
Neurodegenerative disease 383 0.0 4.0
Disease Target Count
Parkinsonism-dystonia infantile 1

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 3.3e-04
osteosarcoma 1.338 9.4e-06
group 4 medulloblastoma 3.100 1.2e-04
diabetes mellitus 1.200 1.3e-03

MLP Assay (20)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
449768 screening 1416 / 0 / 107003 High Throughput Screening for Cocaine Antagonists: Primary Screen
463084 summary 0 / 0 / 0 High Throughput Screening for Cocaine Antagonists
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504858 screening 529 / 0 / 762 High Throughput Screening for Cocaine Antagonists: Retest of Primary Hits
588389 other 169 / 0 / 1122 High Throughput Screening for Cocaine Antagonists:Counterscreen of Primary Hits
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (823)

PMID Text
27167478 Functional polymorphisms of the genes encoding adenosine A2A receptors and dopamine transporters contribute to individual differences in impaired sleep quality by caffeine.
26986136 3'-UTR variable number tandem repeat associated with post-traumatic stress disorder [meta-analysis]
26831905 high SLC6A3 expression in Clear cell renal cell carcinoma tissue was correlated with a shorter period of recurrence-free survival following surgery.
26786096 The NET and DAT N Termini Are Critical for Internalization and Postendocytic Sorting.
26621748 that the cdc42-activated, nonreceptor tyrosine kinase, Ack1, is a DAT endocytic brake that stabilizes DAT at the plasma membrane.
26593110 Study failed to observe a significant association of the SLC6A3 40-base pair variable number of tandem repeats polymorphism (rs28363170) with cognitive function in healthy adults
26504078 Zn(2+) dissociated more rapidly from the inward- than from the outward-facing state of DAT.
26478196 variations in the DAT1 gene may influence the amount of Dopamine availability and the experience of reward in both Substance use disorders and compulsive overeating.
26471374 DAT1 variants are associated with reaction time slops on a reflexive attention task.
26466362 HIV-1 Nef-mediated downregulation of HLA (MHCI) may be affected by/inhibited by SLC6A3 as demonstrated by siRNA genome-wide screen [in HeLa cells)
26442590 the majority of DAT.alpha-synuclein protein complexes are found at the plasma membrane of dopaminergic neurons or mammalian cells
26342565 Higher levels of maternal depressive symptoms predicted reduced cortisol flexibility across challenges for infants with at least one A1 allele of DRD2 and infants with the 10/10 genotype of SLC6A3
26305376 Our study suggests that DJ-1 may also play a role in regulating dopamine levels by modifying DAT activity.
26255829 Computational study providse novel insights into the role of collective dynamics in functionally relevant state-to-state transitions in DAT, at a level of atomistic detail
26245713 we did not find any significant associations of COMT or SLC6A3 with inhibitory performance or impulsivity
26206710 The cortical thickness of right lateral prefrontal cortex is influenced by the presence of the DAT1 10 repeat allele in children and adolescents with ADHD.
26160290 results showed that the methylation status of the BDNF and DAT1 genes had no significant function in the processes of drug addiction
26149737 the 3'-UTR VNTR polymorphism is significantly associated with smoking cessation, and smokers with one or more 9-repeat alleles have a 17% higher probability of smoking cessation than smokers carrying no such allele. [meta-analysis]
26120847 Reductions in dopamine transporter availability may play a pathophysiological role in the development of pure alcohol dependence, given its association with neurocognitive deficits.
26096461 Compared with healthy controls, significant reduction in dopamine transporter availability was found in heroin users at baseline in both the right (by approximately 31.6%) and left striatum.
26073896 DAT1 plays a role in the neurobiology of response inhibition.
26058807 We have found an association between 40 bp VNTR polymorphism of DAT1/SLC6A3 gene and ADHD in the Czech population
26048990 Ctr9, formerly identified as a nuclei protein, interacts with the dopamine transporter in the cytoplasmic compartment.
26041607 No significant association between candidate gene variants and criminal behavior was detected.
26006708 DAT1 10R carriers showed more rule-breaking behavior according to parents when experiencing high peer rejection, but less rule-breaking behavior when experiencing low peer rejection
25963949 these data identify the relative contribution of DNMTs and HDACs in regulating expression of dopamine transporter
25924976 Children without the haplotypes associated with the reduced SLC6A3 gene expression and thus lower dopamine functioning appeared to demonstrate altered levels of effortful control as a function of maternal parenting quality.
25915480 The study results suggest that DAT1 polymorphisms may modulate mood instability traits in the normal population.
25862379 No statistical differences in the general frequency of DAT CpG islands was revealed between patients and control subjects.
25850966 The data presented here show for the first time support for the hypothesis that genetic differences in DAT1 contribute to the variation in subjective responses to cocaine among participants with cocaine use disorders
25850298 A number of 3'UTR nucleotide repeats of an aggression-associated DAT1 gene differs in hadza and datoga Tanzania males.
25840828 This study shown DAT1 to be the risk factor for attention deficit/hyperactivity disorder.
25805645 that variants of SLC6A3 are genetic modifiers of the treatment response to l-DOPA and methylphenidate in Parkinson's disease
25804664 Study found that DAT1 variability did not have any effects on metacontrast masking
25753457 Apathy is associated with reduced striatal dopamine transporter levels in Parkinson's disease patients.
25747272 Results provide dynamic imaging of single DAT proteins, providing new insights into the relationship between surface dynamics and trafficking of both wild-type and attention deficit/hyperactivity disorder-associated transporters
25695767 Study developed a three-dimensional structural model for HIV-1 Tat binding with hDAT, providing novel mechanistic insights concerning how HIV-1 Tat interacts with hDAT and inhibits dopamine uptake by hDAT
25695767 HIV-1 Nef-mediated downregulation of HLA (MHCI) may be affected by/inhibited by SLC6A3 as demonstrated by siRNA genome-wide screen [in HeLa cells)
25687785 As a conclusion, there was no association between 5-HTT, DAT1 and DRD4 genes VNTR polymorphisms and obesity
25684044 Findings suggest that A9 allele and A9/A9 genotype of the SLC6A3 40 bp-VNTR are involved in the vulnerability to alcohol dependence in a Brazilian population.
25683821 DAT1 gene may not contribute to amphetamine dependence susceptibility and specific personality traits observed in amphetamine dependence among Han Chinese men
25656446 Periconceptional alcohol consumption decreases the methylation level of the DAT promoter region of the parent themselves, but not the newborn.
25656223 Permutation analysis showed an influence of the 10/6 DAT1 haplotype on both CAARS-G and CAARS-H, such that attention deficit hyperactivity disorder symptom scores increased with each additional copy of the 10/6 DAT1 haplotype.
25617181 The SLC6A3/DAT1 40 bp-VNTR may affect life expectancy in a sex-specific way.
25604666 HIV-1 Nef-mediated downregulation of HLA (MHCI) may be affected by/inhibited by SLC6A3 as demonstrated by siRNA genome-wide screen [in HeLa cells)
25555995 the putative involvement of DAT1 and DRD4 genes in the aetiology of Attention-deficit hyperactivity disorder with a main role in modulation of key dimensions of the disorder
25547317 This study demonstrated that The bipolar disorder patients had a higher rate of harm avoidance personality traits than the controls, and DAT1 variants may influence personality traits in patients with bipolar disorder.
25526961 Nicotine dependence among current smokers homozygous for the SLC6A3 10r allele was lower than that of smokers carrying minor alleles, a CYP2A6 polymorphism might mediate this association.
25496873 This study reveals that a common genetic variant in DAT1, previously linked with the clinical stages of dementia in humans, and with increased DAT expression in vitro, is associated with several brain-related health factors, including diagnostic, cognitive, and anatomical indices of neurodegeneration, providing new insight into the pathogenesis of Alzheimer's disease
25468771 we propose that anti-DAT titers and DAT genotyping might possibly be used together, to determine a priority for drug intervention based on severity of child's symptoms.
25439653 Compared with healthy controls, opioid-dependent individuals showed a significant reduction in striatal DAT density, which also negatively correlated with non-perseverative errors in working memory.
25411502 participants without the 10-repeat allele of the DAT1 tandem repeat polymorphism possess an enhanced attentional ability to suppress task-irrelevant stimuli in the left hemifield
25339174 the extracellular thin gate is present in monoamine transporters and that a dynamic interaction is required for substrate transport
25331903 studies demonstrate an in vivo functional impact of the DAT Val559 variant, providing support for the ability of DAT dysfunction to impact risk for mental illness.
25313507 Genetic variation in the dopamine transporter (DAT) impacts cross-network connectivity that correlates with measures of impulsivity and inattention.
25271118 Children with OFC were significantly less likely to have the DAT1 10-repeat allele (p = .04).
25247548 The present study suggests that the 10.10 genotype created by the 40-bp 3' UTR VNTR of the DAT1 gene affects crack cocaine abuse and dependence.
25237117 results suggested that pathological gamblers with genetic predispositions toward lower availability of Dopamine and Dopamine 2 receptor density are at a higher risk of cognitive flexibility difficulties.
25212851 The SLC6A3/DAT1 genotype has a significant effect on fronto-striatal activation and performance in Parkinson's disease.
25179220 Comparative modeling and small molecule docking indicated that the tropane pharmacophore of RTI 82 was positioned in the central DA active site with an orientation that juxtaposed the aryliodoazide group for cross-linking to rat DAT Phe-319.
25130782 these results indicated a statistically significant correlation between the inheritance of the SLC6A3 9 repeat allele and the genetic susceptibility to AD in a dose-dependent manner.
25109468 Striatal DAT imaging using 99mTc-TRODAT-1 can be considered a marker for differentiating Parkinson's disease patients from healthy individuals.
25093598 study demonstrates that variation in the SLC6A3 VNTR polymorphism is of importance for interindividual differences in amygdala function
25038551 This study found that bias towards leftward orienting of attention was significantly greater among carriers of the 9-repeat allele of the DAT1 3' VNTR as compared to the individuals who were homozygous for the 10-repeat allele.
25019689 No significant difference in SLC6A3 allelic or genotypic frequency was found between schizophrenia patients and healthy controls
24946437 significant association between the presence of 9/10 DAT1 VNTR genotype and a sweet-liking phenotype in probands was determined.
24929324 no evidence for differential susceptibility based on the selected plasticity genes, in spite of strong EE(Expressed Emotion)-behaviour associations
24911152 neuropsychiatric comorbidity provides additional support for the idea that DAT missense mutations are an ADHD risk factor and suggests that complex DAT genotype and phenotype correlations contribute to different dopaminergic pathologies
24889756 Results show that influence of COMT on social working memory (WM) performance was not accounted for by its influence on either standard WM paradigms; there was no main effect of DAT1 or MAOA, but significant COMTxDAT1 interaction on social WM performance
24849661 The influence of genetic variants on striatal dopamine transporter and D2 receptor binding after traumatic brain injury.
24824713 Individuals carrying long allele variant of DAT1 gene demonstrate hyperreactive cardiovascular stress reactivity characterized by a significant increase in the amplitude and duration of long-latency BP components in cardiac defensive response.
24780147 DAT1 intron8 was associated with parent-rated hyperactivity (etap(2)=.045) and both DAT1 9/10 VNTR (etap(2)=.105) and DRD2 rs2283265 (etap(2)=.069) were associated with teacher-rated inattention.
24753048 aspartate(T62D)-hDAT exhibits reduced [3)H]DA uptake and enhanced baseline dopamine efflux, whereas alanine(T62A) -hDAT and wild type(WT)-hDAT function in an influx-preferring conformation
24723432 Results show that none of the tested DRD2 or DAT1 variants were associated with treatment response to venlafaxine Extended-Release treatment in generalized anxiety disorder
24708432 Substance users and controls significantly differed in allele frequencies of COMT Val158Met but not in allele frequencies of DAT1 3'-UTR VNTR. Neither allele frequencies of COMT Val158Met nor DAT1 3'-UTR VNTR were associated with drug-induced psychoses.
24696011 A review on the DAT 10/10 genotype and the association with attention-deficit-hyperactivity disorder and its endophenotypes.
24680725 Patients with a combination of SERT-in2 ll and DAT 9/10, 9/11, 9/9 and 6/6 genotypes were more likely to have treatment-resistant schizophrenia, compared to those with 10/10 or 10/12 genotype.
24657591 Large, non-clinical study reveals that the selected genetic polymorphisms regulating dopamine (COMT, DRD2 and DAT1) do not influence one aspect of response inhibition, action restraint, as measured by the Go/No-Go task
24633632 rs393795 SNP in SLC6A3 was significantly associated with levodopa-induced dyskinesia latency.
24625311 Report role of DAT1 polymorphisms in controlling actigraphy-derived sleep-wake cycles in young adults.
24613933 eight patients with dopamine transporter deficiency syndrome were found to harbour homozygous or compound heterozygous mutations in SLC6A3, of which the majority are previously unreported variants
24521003 polymorphisms and role in severity of ADHD symptoms
24487615 This study demonistrated that the promoter region of SLC6A3 association with adults of attention deficit hyperactivity disorder.
24461309 A correlation was found between DAT1 VNTR and the subtest "processing speed index" of WISC and the subtest "cognitive flexibility" of executive functions. First to assess DAT1 gene in Colombian population.
24439516 DAT availability in the striatum was no different between subjects with a first-degree family history of major depressive disorder than in healthy subjects.
24403155 the data suggest that the dopamine transporter contributes to homeostatic sleep-wake regulation in humans.
24274990 In heroin-dependent patients, the frequency of DAT gene polymorphism was higher in patients who responded to buprenorphine therapy then in non-responders.
24211691 A meta-analysis indicates that SLC6A3 confers a modest but significant risk for Parkinson's disease.
24193094 A significant effect for DTA1 and a tendency for DRD2 were observed for the DAT1-DRD2 gene pair regarding hostility.
24086483 DAT mRNA levels in peripheral blood leukocytes of chronic schizophrenia patients are over-expressed.
24078578 VNTR polymorphism of DAT1 gene is not associated with susceptibility to Tourette syndrome in Chinese Han population.
24064458 The interaction between DAT1 (but not DRD4) and prenatal tobacco exposure was significant in boys, and patterns differed by sex. Risk for externalizing behaviors for exposed boys increased linearly as a function of the 10r DAT1 allele.
24061496 meta-analyses suggest that in human adults, the 9R allele of the 3'UTR polymorphism of the DAT gene regulates dopamine activity in the striatal brain regions independent of the presence of ADHD or other disorders.
24057505 we found that the DAT 10/10-repeat allele is present more frequently within HIV individuals than in uninfected subjects
24035787 This study showed that variations in genotypes relevant for DAT1 functions are associated more with aging-related impairments in the explicit than the implicit component of sequence learning.
24024899 SLC6A3 may be regulated via either its promoter or the variable number tandem repeats independently by specific signaling pathways and in a haplotype-dependent manner.
24008096 study provides strong evidence to support the suggestion that DNA variation in DAT1 predicts measures of SWM.
23987116 The current meta-analysis indicates that pesticide-induced gene mutations may contribute to increasing susceptibility to Parkinson disease, especially in the GSTP1, SLC6A3, and MDR1 genes.[meta-analysis]
23979605 aberrant DAT function from de novo muation may confer risk for autism spectrum disorder
23968837 Study demonstrates that resting-state striato-frontal functional connectivity is affected by a polymorphism of DAT1, and that DAT1-affected resting-state connectivity predicts executive function
23963056 DAT1 polymorphhisms may predict the vulnerability to the development of the acute extrapyramidal effects in haloperidol-treated schizophrenic patients.
23911780 participants had genotype for a variable number of tandem repeat polymorphism of DAT. Recognition memory for cues from reward and punishment categories was enhanced in participants homozygous for the 10-repeat allele of the DAT, but not in heterozygotes.
23861813 DAT1 polymorphism determines L-DOPA effects on learning about others' social traits.
23808292 A high anxiety level in the Novosibirsk population of 25 to 64-year-old males is substantially associated with variable number of tandem repeat (VNTR) polymorphisms in the DAT and DRD4 genes, considerably increasing the risk of cardiovascular disease.
23761898 The results of this study elucidated the DAT gene's modulation of behavioral and neural responses to drug cues in addiction, suggesting that such responsiveness depends not only on the trait (gene) but also the state (abstinence) of the individual.
23731290 There were no effects of CHRNA4 or DAT1 on either facilitation or inhibition of return.
23704939 The effects of the dopamine agonist apomorphine on experimental pain models in healthy subjects and to explore the possible association between these effects and a common polymorphism within the dopamine transporter gene, were investigated.
23681294 DAT1 polymorphisms predict individual difference in stimulus response episodes.
23653272 Correlations between polymorphisms in genes coding elements of dopaminergic pathways and body mass index in overweight and obese women.
23647133 number of haplotypes (0, 1, or 2) defined by the presence of the nine repeat allele of rs28363170 (VNTR in the 3'UTR) and the C allele of rs27072 (SNP in the 3'UTR) significantly associated with diagnosis of PTSD and total PTSD symptoms
23645138 Tyrosine 470 is a functional recognition residue in the dopamine transporter and is critical for dopamine transport.
23645138 HIV-1 Nef-mediated downregulation of HLA (MHCI) may be affected by/inhibited by SLC6A3 as demonstrated by siRNA genome-wide screen [in HeLa cells)
23637880 no direct and moderating effects of the DRD2, DRD4, or DAT1 genotypes were found on smoking onset in Dutch adolescents.
23588108 SLC6A3 polymorphism is not a reliable predictor of methylphenidate treatment success in attention-deficit/hyperactivity disorder. [meta-analysis]
23541676 These results indicate that the 9/9 ADHD genotype has a different response at 24 weeks treatment with MPH. 10/10 DAT allele seems to be associated with an increased expression level of the dopamine transporter.
23527493 This study showed that children's behavior inhibition at the age of 2 years was predicted by allelic variation in both dopamine transporter and serotonin transporter genes
23524636 Striatal dopamine transporter availability remains intact during long-term antidepressant treatment in patients with major depressive disorder.
23398760 The DAT1 gene 9-repeat variant was associated with child negative affect expressed toward the parent. Parents of children with a 9-repeat allele exhibited more hostility and lower guidance/engagement than parents of children without a 9-repeat allele.
23363412 This study provided novel information regarding the influence of DAT Gene (DAT1, SLC6A3) VNTR Polymorphism on long-term forgetting of episodic information.
23340505 A rare DAT haplotype, formed by the minor alleles of rs3836790 and rs27072, occurred in nearly one-third of the cocaine abusers. Other variants of DAT interact with DRD2 variants in conferring risk of lethal cocaine abuse.
23273726 Findings suggest that an attention-deficit/hyperactivity disorder risk polymorphism (3'-untranslated region) of SLC6A3 has functional consequences on central nervous system dopamine transproter binding in humans
23255304 These data suggest that variants within DAT1 may predispose to a subtype of bipolar disorder characterized by early prodromal features that include attentional deficits.
23215821 No main genetic or interaction effects between SLC6A3 polymorphisms, maternal smoking, and adolscent hyperactivity was found. This fails to replicate earlier findings.
23185343 analysis of Dopamine D1, D2, D3 receptors, vesicular monoamine transporter type-2 (VMAT2) and dopamine transporter (DAT) densities in aged human brain
23161550 Phosphorylation of dopamine transporter serine 7 modulates cocaine analog binding
23153115 We detected a significant interaction between observed praise by parents and child DAT1 (coded additively), which suggested that praise was associated with increased ADHD, but only among youth with the 9/10 genotype.
23137414 Our study failed to demonstrate a clear correlation between sleep disorders and DAT densities in Machado-Joseph disease patients
23128675 Smoking among Russian cancer patients may be related to variations in the DRD2/ANKK1 (Taq1), DRD4 (exon III VNTR), and SLC6A3 genes.
23076524 This is the first report investigated the association between MAOA and DAT1 polymorphism at molecular level in Saudi Arabia population as well as Arab world.
23065263 Methylation and expression profile of CpG islands were examined in the promoters of the brain-derived neurotrophic factor (BDNF) and dopamine transporter (DAT1) genes.
23061530 Findings suggest that genetic variation in the DAT gene influences brain responses associated with attentional bias.
23034259 genetic variations in the dopamine-modulating genes, COMT, DRD4 and DAT1, may contribute to AD pathogenesis in the Taiwanese population.
23032071 Genetic variation at a variable number tandem repeat polymorphism in DAT1 moderates the effects of naltrexone treatment in alcohol dependence.
22958175 In COPD patients, male smoking quitters with DRD2 A1(-) and/or DAT 9R(+) alleles showed accelerated decline in FEV(1) over 5 years similar to continuing smokers. No significant associations were noted between genotype and smoking cessation success.
22940645 These data add to a growing body of evidence showing that spatial attentional asymmetry is a stable quantitative trait, with individual differences in this trait significantly predicted by common DNA variation in the DAT1 gene.
22939506 This results showed that carrying genotypes associated with higher levels of striatal synaptic dopamine (DAT 9/9) and higher density of extrastriatal D2 receptors (C957T CC) were associated with better backward serial recall.
22930791 Dynamical analysis of attention/inhibition measures may unravel new correlates to DRD4 and SLC6A3 variants
22844499 influences of functional variants related to dopamine inactivation in the dopamine transporter (DAT1) and catechol-O-methyltransferase genes (COMT) on the time-course of visual processing in a contingent negative variation
22832428 A functional polymorphism in the DA transporter gene, DAT1, which is predominantly expressed in the striatum, significantly affects fear extinction.
22819977 The androgen receptor facilitates inhibition of human dopamine transporter (DAT1) reporter gene expression
22810728 This study demonistrated that the feedback-related negativity amplitudes were enhanced for nine-repeat-allele carriers of the DAT in health female.
22778840 In transfected HEK2 cells, basal activity of Akt2 regulates DAT cell surface expression.
22749356 genetic association study in population in Netherlands: Data suggest variable repeat sequences in SLC6A3 gene are associated with decreased striatal neurotransmission in reward processing in patients with attention deficit disorder/hyperactivity.
22745713 Molecular variation at the SLC6A3 locus predicts lifetime risk of PTSD in the Detroit Neighborhood Health Study.
22733030 The results of this study found no main or interaction effects attributable to DAT1 with Bulimia-Spectrum Disorders in women.
22723947 We find that carriers of DAT1 alleles, which presumably result in lower striatal dopamine availability, showed more risk taking, relative to carriers of the alleles associated with higher striatal dopamine availability.
22711722 No association was found between DAT polymorphisms and apparent life-threatening events (ALTE) and idiopathic form (IALTE)groups either at the genotype or allelic level.
22698582 Our study extends and confirms previous results and, for the first time, tested the gene-gene interaction between SLC6A3 and DRD2 in alcohol dependence.
22691013 The DAT1 VNTR was significantly associated with alcoholism in Badaga population but not in Kota population of south India.
22689927 (18)F-FE-PE2I is a promising PET radioligand for quantifying DAT
22683321 findings suggest that genes acting in the dopamine system interact to influence both eating-related and personality psychopathology.
22682503 The DRD2 and DAT1 genotype has an additive effect on the magnitude of error-related negativity.
22646917 DAT1 interacts with maltreatment to predict attention deficit hyperactivity disorder (ADHD) symptoms and ADHD status derived from latent class analysis; symptoms differ between boys and girls.
22564179 In children with ADHD, an index of inattention was associated with DRD4 but not DAT1, and an index of impulsivity was associated with DAT1 but not DRD4.
22551036 Epistasis between dopamine transporter, SLC6A3, and OPRM1 gene needs to be taken into account when examining differential genetic response to alcohol in early-stage alcoholics.
22514303 The results of thisstudies support a coupling of DAT microdomain localization with transporter regulation and provide evidence of perturbed DAT activity and DA signaling as a risk determinant for Attention deficit/hyperactivity disorder.
22494359 Human carriers of the 9-repeat allele of dopamine transporter DAT show increased approach-avoidance tendencies compared to non-9-repeat carriers.
22454241 This study demonistrated that Genetic polymorphisms of DAT affect verbal and visuospatial working memory functioning.
22438994 The 10-repeat allele of the variable number of tandem repeats marker (VNTR) in the dopamine transporter gene and the Met allele of the catechol-o-methyl transferase (COMT) Val158Met polymorphism were associated with greater vulnerability to time-on-task.
22438288 Significant interactions between the effects of G72 and DAT polymorphisms on activation were evident in several brain areas
22435397 DAT density of Restless Leg Syndrome patients was increased in the caudate, posterior putamen and entire striatum compared to controls. DAT density was higher in the anterior putamen of RLS patients than controls though statistically not significant.
22427685 study not find a significant association between 4 novel SNPs and in vivo striatal DAT availability
22408582 evaluated the potential association of four variants of dopaminergic candidate genes in RDS (dopamine D1 receptor gene [DRD1]; dopamine D2 receptor gene [DRD2]; dopamine transporter gene [DAT1]; dopamine beta-hydroxylase gene [DBH]).
22366190 The present results suggest that the DAT1 gene may be mainly involved in the development of the positive symptoms in the Chinese population.
22342155 Temperament traits: found a significant main effect of DAT1 on sensory sensitivity.
22279524 Study identified sequence variants in the known disease-causing genes SLC6A3 and FLVCR1, and present evidence to strongly support the pathogenicity of variants identified in TUBGCP6, BRAT1, SNIP1, CRADD, and HARS.
22182296 The results of this study suggested that genetic differences in DAT1 in children with ADHD influence their susceptibility to a behavioral intervention directed at shaping their environment through their parents.
22177721 centrosomal aggregates and fragmentation of Golgi apparatus are 2 closely related processes that could result in the disruption of the vesicular transport of DAT toward the plasma membrane in a model of dopaminergic neuronal degeneration.
22163275 in the early pathogenesis of PD, alpha-synuclein acts as a fine modulator of the dopaminergic synapse by regulating the subcellular distribution of key proteins such as the DAT
22162768 Dopamine transporter (DAT1) and dopamine receptor D4 (DRD4) genotypes differentially impact on electrophysiological correlates of error processing
22160470 121-bp is a silencer in vitro that might coordinate with transcriptional activities both inside and outside 121-bp in regulation of hDAT.
22157025 There is a dose-response relationship between the number of packs smoked per day and SUR in the striatum
22156764 Results suggest that striatal DAT levels are not altered in the early stages of schizophrenia before medication is introduced. We identified gender differences and aging effects that could have significance for future studies.
22138326 5-HTTVNTR, and the interaction between 5-HTTVNTR and DATVNTR may be associated with the comorbidity of antisocial personality disorder in male heroin-dependent patients.
22119468 analysis of Compound (+/-)-[(125)I]-3, which represents the first successful example of a DAT and nAChR photoaffinity ligand based on the bupropion scaffold
22113132 Genotyping was performed for variants of the DRD2 Taq1A (rs1800497), COMT Val(158)Met (rs4680), DAT1 (3' UTR 40bp VNTR). Variants of DRD2 Taq1A, COMT and DAT1 were not associated with the risk of developing ICDs.
22103304 Novel data are presented showing that variation in the dopamine transporter gene (DAT1) influences improvements in working memory and fluid intelligence in preschool-age children following cognitive training.
22082040 This study did not find evidence to support direct or interactive effects of SLC6A3 and HIV disease severity on neurocognitive
22081881 This study demonistrated that Statistically significant effects were found for DAT1, DRD2, DRD4, and the dopamine index for highest level of education.
22047966 We found that connections between frontal, parietal, and striatal nodes showed higher functional connectivity in 10/10 homozygotes of the DAT1 gene
22026501 The human dopamine transporter (hDAT) is an important regulator of DA neurotransmission and a target of psychostimulant drugs of abuse such as cocaine.
22006250 The expression of human SERT and DAT on developing megakaryocytes and platelet-like particles derived from the megakaryocyte progenitor cell line, was investigated.
21990355 alpha-Synuclein stimulates a dopamine transporter-dependent chloride current and modulates the activity of the transporter
21957239 Dopamine transporter and Rin (Rit2) directly interact; colocalization reveals that DAT/Rin associations occur primarily in lipid raft microdomains.
21889247 This finding suggests that the DAT1 gene polymorphism may influence a common neural mechanism underlying both reading acquisition and ADHD symptoms.
21883027 Evaluation of the pupil light reflex is evaluated in patients with Parkinson's disease in order to study the relationship between pupillometry parameters and the presynaptic dopaminergic system.
21876545 Allelic variation in polymorphisms of the dopamine ransporter gene (SLC6A3: rs37020; rs460000) predicted individual differences in SSRT.
21873779 the Valachian Roma population is genetically different from the Hungarian population in the distribution of SLC6A3 alleles, which might indicate altered susceptibility to certain neuropsychiatric disorders
21826203 Genotype and ancestry modulate SLC6A3 density in midbrain.
21812871 These results support the existence of a decrease in DAT availability associated with tobacco and cannabis addictions involving all dopaminergic brain circuits.
21802993 Compared with controls, patients with rapid-eye movement sleep behavior disorder had significantly reduced mean dopamine transporter binding in all four striatal regions at baseline and after 3 years.
21801841 we find that a well-characterized polymorphism in the dopamine transporter (DAT1) contributes to individual differences in striatal response for gain-oriented risks
21799208 There was no effect of either DAT1 genotype or bromocriptine on involuntary attention, but participants with DAT1 alleles predicting higher striatal dopamine had a larger inhibition of return
21716015 higher DAT density in the striatum was associated with a decrease in the regional cerebral blood flow in the cortical and subcortical attention network
21672565 There was a direct association for SLC6A3 gene and high-calorie sweet food intake and an interaction between depressive symptoms and SLC6A310/10 genotype with increased consumption high-calorie sweet foods.
21644994 The dopamine carrier protein (DAT, DA transporter) embedded in the dopamine cell membrane is known to clear previously released amines through an inward dopamine influx--{REVIEW}
21609749 Population-based anal showed signif assoc of DAT1 3'UTR VNTR lower repeat (6R & 7R) alleles intron8 VNTR 5R allele w/idiopathic intellectual disability. altered dopaminergic neurotransmission may lead to impairmed cognition & behavioral problems
21596533 This study showed that default-mode network suppression is likely linked to DAT1 and to severity of inattention in attenotion attention-deficit/hyperactivity disorder.
21595008 results rather suggest additive effects of the DRD4 risk haplotype and the SLC6A3 gene
21554332 Meta-analyses suggest a possible association between the SLC6A3 VNTR A9 and alcoholic subgroup with Alcohol Withdrawal Seizures or Delirium Tremens
21538554 HIV-1 Nef-mediated downregulation of HLA (MHCI) may be affected by/inhibited by SLC6A3 as demonstrated by siRNA genome-wide screen [in HeLa cells)
21525861 Dopamine transporter gene single nucleotide polymorphisms in brain are significantly associated with bipolar disorder.
21516943 There were no significant differences in the allele and genotype frequencies between the case and control group
21491204 Results examine the role of brain-derived neurotrophic factor, dopamine transporter, and serotonin transporter polymorphisms in the development of posttraumatic stress disorder in victims of urban violence.
21445667 Although the functional significance of DAT1 variable tandem repeats is less defined, our results point to a potential influence of SLC6A3 on startle magnitude.
21404331 This meta-analysis provides no evidence that SLC6A3 variable tandem repeats are associated with interindividual differences in dopamine transporter availability in the human striatum.
21399631 Flot1-enriched membrane microdomains are required for protein kinase C-regulated internalization of the DA transporter (DAT) and the glial glutamate transporter EAAT2.
21354244 There were significant effects of SLC6A3 polymorphism on persistence in both genders
21304140 Dopamine transporter was decreased in corpus striatum in patients with major depressive disorder and even more so in Parkinson's disease patients.
21299752 Despite heterogeneity introduced by a host of factors, including variance in other genes involved in smoking behavior, we confirm that DAT genotype predicts the direction and location of neural responses to SCs.
21298009 a detailed mechanistic proposal for the dynamic changes associated with substrate transport in DAT
21295544 this finding that SCAMP2 interacts with and regulates the subcellular distribution of both DAT and SERT suggests that interaction with SCAMP2 may constitute an important mechanism for coordinating cell surface expression of monoamine transporters.
21290414 In this study, we analyzed the effects of HESR1, -2, and -3 on DAT1 expression in human neuroblastoma SH-SY5Y cells
21272388 no significant effects of polymorphorphisms on working memory task performance
21247255 Negative findings with the DAT1(VNTR) polymorphism are in childhood aggression contrast to previous positive findings.
21232548 The results identify regional specificity concerning which functional differences can be attributed to the possession of the high risk of ADHD with DAT1 genotypes
21207241 This study further examined the association between ADHD and the DRD4, DAT1, and 5HTT genes by testing their association with multivariate phenotypes derived from continuous measures of ADHD symptom severity.
21176997 We find that in patients with striatal dopaminergic neurodegeneration serum BDNF levels decrease along with loss in striatal DAT binding.
21171728 There was a significant inverse relation between parenting at 4-6 years and number of later child behavior symptoms, primarily in children with a polymorphism in the 3' untranslated region of the dopamine transporter gene
21150814 A major role for DAT1 in the susceptibility to major depression, is not confirmed.
21149640 role of a thr residue within sequence RETW, located near transmembrane domain 1, in regulating NET and DAT function; results concur with notion that T-->D mutation in RETW alters preferred conformation of hNET and hDAT to favor one more inward facing
21147099 cellular iron depletion regulates DAT expression through reducing mRNA stability as well as an increasing in endocytosis
21113497 changes in functional status of mental exercise were studied in carriers of variants of DAT1, DRD2 and COMT; significant relationship between DAT1, DRD2 and COMT polymorphism and changes in mental sphere status were revealed -- most pronounced in girls
21112253 Children with mutations in the SLC6A3 childhood, patients developed severe parkinsonism-dystonia associated with an eye movement disorder and pyramidal tract features.
21083670 Observational study of gene-disease association. (HuGE Navigator)
21078357 Meta-analysis of gene-disease association. (HuGE Navigator)
21050355 The findings suggest that DAT1-VNTR polymorphisms resulting in higher dopamine concentrations were associated with vulnerability to premature ejaculation.
21050355 Observational study of gene-disease association. (HuGE Navigator)
21049181 SLC6A3 A1343G single nucleotide polymorphism was associated to the SCZ phenotype in schizophrenia.
21049181 Observational study of gene-disease association. (HuGE Navigator)
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20962236 HIV-1 Nef-mediated downregulation of HLA (MHCI) may be affected by/inhibited by SLC6A3 as demonstrated by siRNA genome-wide screen [in HeLa cells)
20960275 polymorphisms in the DAT1 40 base pair (bp) VNTR genotype do not predict growth hormone deficiency or response to GH therapy in short children
20960275 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20957668 Altered caudate development associated with 10-repeat homozygosity of DAT1 may contribute susceptibility to attention deficit hyperactivity disorder.
20957647 analyses identified a novel cassette exon at SLC6A3 that is alternatively spliced; association analyses provide mixed support for a link between SLC6A3 polymorphisms and schizophrenia pathogenesis
20953736 A decrease in dopamine reuptake due to reduced DAT availability causes a shorter sleep duration in poor sleepers.
20933528 The present results suggest that individuals homozygous for the 10-repeat allele fail to detect the behavioral relevance of new stimuli at early stages.
20862259 Observational study of gene-disease association. (HuGE Navigator)
20856247 This study demonistrated that homozygotes for the 3 allele of the Int8 VNTR in DAT1 show disruption of normal reward related processes mediated by the orbitofrontal cortex.
20845394 This study demonistrated that Association between reward-related activation in the ventral striatum and trait reward sensitivity is moderated by dopamine transporter genotype.
20845394 Observational study of gene-disease association. (HuGE Navigator)
20817043 presence of the DAT1 9-repeat allele was beneficial for implicit sequence learning.
20817043 Observational study of gene-disease association. (HuGE Navigator)
20800641 finding of the haplotype rs27048 (C)/rs429699 (T) as a novel genetic marker in the inattentive ADHD subtype suggests that variation in the DAT1 gene may primarily affect the inattentive subtype of ADHD.
20800641 Observational study of gene-disease association. (HuGE Navigator)
20739786 Lower expression in DAT in striatum in Tourette syndrome.
20736997 results link variation in genes influencing dopamine signaling in the prefrontal cortex (COMT(Val158Met)) and the striatum (DAT1(10/6)) with discounting rates in a hypothetical task and self-ratings of trait impulsivity in ADHD-CT and healthy controls.
20736997 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20732903 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20731709 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20700532 the importance of isoforms of catecholamine transporters in monoaminergic signaling in the brain and peripheral tissues
20688912 Data support the hypothesis that the dopamine transporter (DAT) adopts an outward facing conformation in a cholesterol-rich membrane environment, suggesting a novel modulatory role of the surrounding membrane lipid milieu on DAT function.
20685009 This study demonistrated that Significant associations were observed between the dopamine transporter gene (DAT) 3' variable number tandem repeats (VNTR) and "agitation" and aberrant motor behavior.
20685009 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20678555 Observational study of gene-disease association. (HuGE Navigator)
20672519 no connection between analysed polymorphism of genes: DRD2, DRD3, DRD4, DAT, COMT and schizophrenia was stated.
20672519 Observational study of gene-disease association. (HuGE Navigator)
20661460 Observational study of gene-disease association. (HuGE Navigator)
20644949 serotonin transporter was negatively associated with DAT in the striatum but not within the midbrain in Parkinson's disease
20631685 A significant effect of the SLC6A3 dopamine transporter genotype on the neurophysiological correlates of cognitive response control is found in adults with attention deficit hyperactivity disorder.
20631685 Observational study of gene-disease association. (HuGE Navigator)
20631684 [review] A recent spate of evidence implicating a role for genes controlling dopaminergic function in frontostriatal circuitry includes DAT1.
20620172 We report significant epistasis between COMT Val(1)Met and DAT1 VNTR on cortisol reactivity and stress recovery.
20620172 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20603187 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20593420 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20580759 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554017 The DAT polymorphisms explained the variation seen in Post-Traumatic Stress Disorder diagnosis, total Post-Traumatic Stress Disorder symptom severity, and categories B and C symptom severities.
20551163 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20548783 a unique combination of the genomic features and the regulatory attributes enables the differential expression of the DAT1 gene and fulfills seemingly contradictory demands to its regulation; that is, robustness of expression and functional dynamics
20505557 This study was aimed at investigating whether distinct haplotypes, defined by polymorphisms associated with the expressions of DAT and SERT, were associated with subgroups of alcohol dependence.
20505557 Observational study of gene-disease association. (HuGE Navigator)
20505554 The polymorphisms within the dopamine transporter gene (DAT1/SLC6A3), the dopamine receptor D2 gene and the dopamine beta-hydroxylase gene (DBH) in a Spanish sample of patients with cocaine addiction and sex-matched controls, were investigated.
20505554 Observational study of gene-disease association. (HuGE Navigator)
20497233 No statistically significant differences in allele or genotype frequencies of all investigated variants between HD patients and controls were observed.
20497233 Observational study of gene-disease association. (HuGE Navigator)
20493539 No correlation between Int8 VNTR and either the inter-individual variability of the sleep architecture, or the DAT availability, as measured by single photon emission computed tomography (SPECT) and TRODAT-1 Tc-99m was observed.
20493539 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20464528 Observational study of gene-disease association. (HuGE Navigator)
20463658 This genetic imaging (SLC6A3) study indicates a critical role for human striatal dopamine in reward anticipation and its influence on cognitive flexibility.
20461808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20459035 The 40 bp VNTR polymorphism of DAT1 may not be correlated to the susceptibility to cancer in a Chinese Uighur population.
20459035 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20450954 This study suggested that among several performance monitoring-related cortical evoked potentials it is the Pe and SPN that might be endophenotypes for ADHD with the DAT1 gene being one of the genes affecting these endophenotypes.
20450954 Observational study of gene-disease association. (HuGE Navigator)
20430042 This study reported a significant association between DAT1 and a perceptual measure of spatial bias in healthy adults.
20430042 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20427663 identify a signaling network downstream of D(2)R activation, normally constraining DA action at synapses, that may be altered by DAT mutation to impact risk for dopamine-related disorders
20391341 There is a tendency towards an association between the homozygous TT genotype of the rs40184 single nucleotide polymorphism in DAT1 gene and an increased risk for major depressive disorder in the northeastern Thai population.
20391341 Observational study of gene-disease association. (HuGE Navigator)
20367960 The 10-repeats allele and 10/10 genotype of 40 bp VNTR polymorphism of DAT1 may increase the risk of breast cancer in Chinese Han population.
20367960 Observational study of gene-disease association. (HuGE Navigator)
20338240 Reduced 2-carbomethoxy-8-(3-fluoropropyl)-3-(4-iodophenyl)tropane binding in ventral striatum of patients with Parkinson's and pathologic gambling syndrome is associated with lower dopamine transporter expression and increased synaptic dopamine levels.
20332413 Our findings do not support SLC6A3 as marker genetic susceptibility factor in adult ADHD.
20332413 Observational study of gene-disease association. (HuGE Navigator)
20218802 VNTR polymorphisms associated with temperamental personality trait persistence in Austrian Caucasians
20218802 Observational study of gene-disease association. (HuGE Navigator)
20210499 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20205808 Observational study of gene-disease association. (HuGE Navigator)
20179766 Data indicate that the protective effect of DAT1*9R/9R cannot be explained away by background characteristics.
20179766 Observational study of gene-disease association. (HuGE Navigator)
20170711 There is no association between the DRD2 and DAT1 polymorphisms and CD.
20170711 Observational study of gene-disease association. (HuGE Navigator)
20161733 Data show that introduction of tetraCys into extracellular loops 3 and 4 yielded DATs with severely compromised function that failed to mature and traffic to the cell surface.
20146095 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20141587 Carriers of the 10R10R genotype had scores indicating a lower threshold to ejaculate on each of the indicators compared to the combined 9R9R/9R10R carrier group.
20141527 stereotypy of cerebral responses reveals different patterns of cognitive control according to the DAT1 gene polymorphism.
20132487 These data implies that altered DAT function may contribute to impaired DA neurotransmission and clinical symptoms in human DYT1 dystonia.
20117122 Observational study of gene-disease association. (HuGE Navigator)
20098830 Results provide evidence for the association between the 6-repeat allele of the investigated polymorphism and attention deficit disorders with hyperactivity in a Brazilian sample of adult patients.
20098830 Observational study of gene-disease association. (HuGE Navigator)
20091113 Polymorphisms in dopamine transporter (SLC6A3) are associated with stimulant effects of D-amphetamine
20091113 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20086298 The present case-control study was performed for the first time in an Iranian population to study the association between the -839C/T polymorphism in the SLC6A3 gene promoter and schizophrenia.
20086298 Observational study of gene-disease association. (HuGE Navigator)
20074437 Observational study of gene-disease association. (HuGE Navigator)
20053379 10-repeat homozygosity of DAT1 was associated with reduced performance and a lack of increased basal ganglia involvement under higher working memory demands.
20053379 Observational study of gene-disease association. (HuGE Navigator)
20051513 role of WW3 and WW4 domains of Nedd4-2 in dopamine transporter ubiquitination was demonstrated; siRNA analysis demonstrated that this polyubiquitination is mediated by Nedd4-2 cooperation with UBE2D and UBE2L3 E2 ubiquitin-conjugating enzymes
20049490 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20041956 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20033274 Observational study of gene-disease association. (HuGE Navigator)
20026227 neural activity related to inhibitory control may differ as a function of DAT1 3'UTR genotype in youth with attention-deficit hyperactivity disorder
20026227 Observational study of gene-disease association. (HuGE Navigator)
20021740 The combination of DAT imaging showing reduced DAT density and longitudinal clinical observation of equivocal cases enabled a way to differentiate Parkinson's disease from other conditions.
20006992 Observational study of gene-disease association. (HuGE Navigator)
19960520 Dopamine and the DAT allele may contribute to one heritable path in a multifinality model of the development of PTSD.
19960520 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19944766 Observational study of gene-disease association. (HuGE Navigator)
19906444 Observational study of gene-disease association. (HuGE Navigator)
19892410 Observational study of gene-disease association. (HuGE Navigator)
19890261 A differential association of DAT1 minisatellite repeat (VNTR) haplotype in persistent attention deficit/hyperactivity disorder (ADHD) suggests involvement of this gene in childhood and persistent ADHD.
19890261 Observational study of gene-disease association. (HuGE Navigator)
19884604 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19879111 The promoter region of the DAT1 gene may play a role in increasing susceptibility to schizophrenia, but does not affect the severity of psychotic symptoms in Han Chinese.
19879111 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19858760 This article confirms and expands previous studies suggesting that genes moderate ADHD treatment response. The ADHD outcomes are not unitary but reflect both behavioral and learning domains that are likely influenced by different genes.
19858760 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19844206 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19827313 Observational study of gene-disease association. (HuGE Navigator)
19819301 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19818050 Observational study of gene-disease association. (HuGE Navigator)
19805704 heterogeneity in selective attention in ADHD can be explained by a replicated genetic risk factor for ADHD, the 10/3 DAT1 haplotype
19796878 The results of this study showed that significant associations between cold pain tolerance and DAT-1 (p = 0.008).
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19779799 The results demonstrate the variability of the DAT1 40-bp variable number of tandem repeat polymorphism in Indian populations and revealed a high similarity with East Asian populations.
19779799 Observational study of gene-disease association. (HuGE Navigator)
19772578 Observational study of gene-disease association. (HuGE Navigator)
19769301 Role of dopamine transporter gene (DAT1) polymorphisms in personality traits variation
19769301 Observational study of gene-disease association. (HuGE Navigator)
19767592 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19766189 These results strongly suggest that DAT glycosylation is involved in the differential vulnerability of midbrain dopamine cells in Parkinson's disease.
19766158 This study provides evidence that a genetic variant in the DRD2 gene and possible interaction between DRD3 and SLC6A3 genes are associated with schizophrenia.
19766158 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19764934 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19764480 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19761593 Polymorphic variants of SLC6A3 genes may influence some aspects of the smoking behavior, including age of starting regular smoking, the level of cigarette consumption, and periods of abstinence
19761593 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19740369 DAT1 gene is found to relate to alcohol and nicotine consumption.
19740369 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19739106 a variation in the SLC6A3 gene and possibly the DRD2 gene may protect for delirium
19739106 Observational study of gene-disease association. (HuGE Navigator)
19728374 Patients with eating disorders showed an elevated expression of DAT mRNA when compared with the controls and a downregulation of the DRD expression
19726478 Subjects with the 9-repeat allele of DAT1 (lower DA tone) are more risk-tolerant over gains than subjects with the 10-repeat allele.
19717274 Observational study of gene-disease association. (HuGE Navigator)
19693267 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19676101 dopamine transporter gene (SLC6A3) variation has a role in dorsal anterior cingulate function in attention-deficit/hyperactivity disorder
19676101 Observational study of gene-disease association. (HuGE Navigator)
19673036 Observational study of gene-disease association. (HuGE Navigator)
19666577 These data demonstrate that COMT and DAT genes interact nonadditively to modulate cortical function during executive processing.
19666577 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19664686 Observational study of gene-disease association. (HuGE Navigator)
19655343 Genetic polymorphisms of DAT1 involved in dopamine neurotransmission moderate the effects of severe early institutional deprivation on symptoms of Attention-Deficit/Hyperactivity Disorder (ADHD.
19655343 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19647327 No significant association was shown between the polymorphisms of the DAT1 gene studied and response to lithium treatment.
19647327 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19621370 Observational study of gene-disease association. (HuGE Navigator)
19590691 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19590515 Observational study of gene-disease association. (HuGE Navigator)
19576958 one of three SNP markers (rs11564750) in the 5' promoter region of the DAT1 gene is significantly associated with ADHD
19519258 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19513381 Observational study of gene-disease association. (HuGE Navigator)
19506906 Meta-analysis of gene-disease association. (HuGE Navigator)
19506579 Observational study of gene-disease association. (HuGE Navigator)
19494806 In this study, the SLV6A3 Single Nucleotide Polymorphisms rs2975226, rs2652510, and rs2652511 is in association with increased Fagerstrom Test for Nicotine Dependence scores among both treatment-seeking and community smokers.
19494806 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19490304 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19482231 These data suggest that the neurophysiological response during response inhibition may be a suitable intermediate phenotype as the influence of SLC6A3 variation was detectable on neural response.
19482231 Observational study of gene-disease association. (HuGE Navigator)
19478460 loss-of-function SLC6A3 mutations that impair dopamine transporter-mediated dopamine transport activity are associated with an early-onset complex movement disorder
19450132 Several studies have found that the DAT1 variable number tandem repeat (9-repeat allele) is associated with alcohol-withdrawal symtoms [REVIEW].
19447357 This is the first report of epistasis between COMT and dopamin transporter genes on eating behavior. Specifically, the Met/10 and Val/9 genotypes were associated with elevated binge eating and eating psychopathology.
19443134 we found that the DAT1 polymorphism interacted with paternal alcoholism to predict serious alcohol problems among males
19418498 Observational study of gene-disease association. (HuGE Navigator)
19409950 In boys with attention-deficit/hyperactivity disorder, verbal IQ is highly correlated to externalizing behavior in those carrying both the DAT1 and DRD4 risk alleles.
19409950 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19390575 Observational study of gene-disease association. (HuGE Navigator)
19388000 Observational study of gene-disease association. (HuGE Navigator)
19376159 The present study suggests that the -67 A/T promoter polymorphism, but not intron 8 VNTR polymorphism, in the DAT gene affects personality traits of Japanese healthy females
19376159 Observational study of gene-disease association. (HuGE Navigator)
19368898 the 9-repeat allele of the dopamine transporter is associated with angry-impulsive personality traits, independent of any link to mood disorder or BPD.
19368898 Observational study of gene-disease association. (HuGE Navigator)
19364291 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19360691 Observational study of gene-disease association. (HuGE Navigator)
19352220 present findings suggest that DAT1 genetic variation influences drinking behavior in our Finnish population, where the rs6350 A and rs463379 G alleles provide a protective role against high alcohol consumption and alcohol dependence, respectively
19352220 Observational study of gene-disease association. (HuGE Navigator)
19352218 Observational study of gene-disease association. (HuGE Navigator)
19309018 Adjusted for age, cognitive impairment, and functional impairment, three SNPs in the DRD2 gene and seven SNPs in the SLC6A3 gene were associated with delirium; none of these associations was significant after correction for multiple testing
19309018 Observational study of gene-disease association. (HuGE Navigator)
19304505 There were no significant differences in the DAT gene allelic frequencies of C252T, C1820T and T1054C between the patients and the controls
19304505 Observational study of gene-disease association. (HuGE Navigator)
19288168 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247849 Observational study of gene-disease association. (HuGE Navigator)
19196467 genetic variation in the promoter region of DAT1 may be a risk factor in the development of ADHD
19196467 Observational study of gene-disease association. (HuGE Navigator)
19193883 Residues 60-65 proximal to the first transmembrane domain of dopamine transporter (DAT) are critical for retention of DAT at the plasma membrane and/or prevention of rapid constitutive endocytosis of DAT.
19183461 Our results support a role of genetic variation at the dopamine transporter gene, SLC6A3, as a modifier of body mass index
19183461 Observational study of gene-disease association. (HuGE Navigator)
19176830 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19152006 Observational study of gene-disease association. (HuGE Navigator)
19146920 No association between ADHD and the 7R allele of DRD4 or the 10R allele of DAT1 was observed; however, patients with comorbidities had a lesser frequency of genotypes with the 7R allele of DRD4 and the 10/10 genotype of DAT1.
19146920 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19142409 Observational study of gene-disease association. (HuGE Navigator)
19120712 There were no associations of tic severity with the DAT1 DdeI polymorphism.
19120712 Observational study of gene-disease association. (HuGE Navigator)
19104049 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19098122 Threonine-62 in the juxtamembrane N-terminal domain of the human dopamine transporter (DAT) plays a critical role in transporter function, as examined in a structural context using dynamic simulations of a three-dimensional molecular model of DAT.
19091889 A combination of polymorphisms in both the 3' and the 5' ends of the DAT gene is associated with in vivo striatal DAT expression.
19091889 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19025233 Evidence for association between hyperactive-impulsive ADHD symptoms and DAT1 and between inattentive ADHD symptoms and DRD4.
19025233 Observational study of gene-disease association. (HuGE Navigator)
18973248 No significant genotype or haplotype associations with depression in Parkinson disease were observed for SLC6A3.
18973248 Observational study of gene-disease association. (HuGE Navigator)
18937842 Observational study of gene-disease association. (HuGE Navigator)
18937294 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18841010 DAT1 3'-UTR variable tandem repeat could play a role in susceptibility to irritability and aberrant motor behavior in Alzheimer's disease
18841010 Observational study of gene-disease association. (HuGE Navigator)
18831910 Data show that in two cases of metachromatic leukodystrophy, polymorphisms the serotonin and dopamine transporter genes are related to the symptomatology of schizophrenia and/or depression.
18826446 Observational study of gene-disease association. (HuGE Navigator)
18821566 Observational study of gene-disease association. (HuGE Navigator)
18810510 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18802924 Association of SLC6A3 gene 9-6 haplotype with adult ADHD is reported.
18802924 Observational study of gene-disease association. (HuGE Navigator)
18802919 A common haplotype at SLC6A3 5' region is associated with ADHD.
18802919 Observational study of gene-disease association. (HuGE Navigator)
18788325 10R allele of DAT1 gene associated with self-reported delinquent peer affiliation for male adolescents from high-risk environments.
18788325 Observational study of gene-disease association. (HuGE Navigator)
18779819 This study provided the first evidence on the role of variations in DAT1 in individual differences in observed maternal parenting behavior in child disruptive behavior.
18779819 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18769827 the simultaneous presence of both DRD4 7-repeat heterozygosity and DATl 10 allele homozygosity was significantly higher (22.5%) in cases (40), compared with (2.8%) unaffected siblings (36), with an odds-ratio of 10.16.
18769827 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18762727 findings do not support the hypothesis that DAT1 gene variants contribute to the pathogenesis of ADHD in Chinese Han population
18762727 Observational study of gene-disease association. (HuGE Navigator)
18729135 An association was found between neuropsychological measures and SLC6A3 in ADHD only in adolescents.
18729135 Observational study of gene-disease association. (HuGE Navigator)
18720903 The researchers found evidence of some selective pressure in the polymorphism frequencies of the dopamine transporter gene hypervariable region in a sample of Ivory Coast and Italian populations
18720903 Observational study of genotype prevalence. (HuGE Navigator)
18704100 genetic variation in the DAT gene contributes to the neural and behavioral responses elicited by smoking cues.
18690118 We explored associations of gene variants in the dopamine, opioid, and serotonin pathways with smoking reward ('liking') and reinforcement (latency to first puff and total puffs) as a function of negative mood.
18690118 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18690117 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18668530 Association of ADHD with genetic variants in the 5'-region of SLC6A3: evidence for allelic heterogeneity.
18668530 Observational study of gene-disease association. (HuGE Navigator)
18665883 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18588943 When using midbrain [123I] nor-beta-CIT binding as a marker of SERT binding, no differences are detectable between patients with DD and MD. However, low striatum [123I] nor-beta-CIT binding is associated with a longer illness duration in dysthymia.
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18580852 Observational study of gene-disease association. (HuGE Navigator)
18563707 Pharmacogenetics of methylphenidate response in ADHD: association with SLC6A3 gene is reported.
18563707 Observational study and meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18563706 SLC6A3 genotype was not associated with smoking status at 1 year.
18563706 Observational study of gene-disease association. (HuGE Navigator)
18559107 SLC6A3 genotype may modulate components of executive function performance in children with ADHD.
18559107 Observational study of gene-disease association. (HuGE Navigator)
18553640 Genetic heterogeneity in ADHD: SLC6A3 gene only affects probands without conduct disorder.
18553640 Observational study of gene-disease association. (HuGE Navigator)
18553389 DAT1 genotype was not associated with schizophrenia.
18553389 Observational study of gene-disease association. (HuGE Navigator)
18552399 Observational study of gene-disease association. (HuGE Navigator)
18504048 Data show that promoter specific methylation of the dopamine transporter gene is altered in alcohol dependence and associated with craving.
18468730 The above suggests that cleavage of DAT by calpain may significantly modify dopamine homeostasis under pathological or physiological conditions.
18446263 No evidence of transmission disequilibrium was detected for alleles of the DAT1 polymorphisms in early onset of obsessive-compulsive disorder.
18444252 Observational study of gene-disease association. (HuGE Navigator)
18434921 Among current smokers, intention to quit was significantly lower in adolescents homozygous for the 10-repeat allele of the common dopamine transporter 3' untranslated region polymorphism.
18434601 MKP3 can act to enhance DAT function and identifies MKP3 as a phosphatase involved in regulating dynamin-dependent endocy
18426798 analysis of how an intracellular interaction network regulates conformational transitions in the dopamine transporter
18404133 Some ADHD polymorphisms (in genes DAT1, DRD2, DRD3, DBH, 5-HTT) in case-control study.
18404133 Observational study of gene-disease association. (HuGE Navigator)
18393256 The expression of DAT can be inhibited effectively by the antisense ODN, and the response of the rats to the MPTP was reduced upon DAT inhibition.
18374902 DAT 9-repeat carrier alleles modulated activity in the hippocampus in the exact opposite direction of DAT 10/10-repeat alleles based on COMT Val(158)Met genotype during different memory conditions.
18374902 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18366104 Analyses revealed that two of the three polymorphisms (i.e., His452Tyr and DAT1) were associated with adolescent ASB.
18366104 Observational study of gene-disease association. (HuGE Navigator)
18361424 evidence supporting a role for SLC6A3 in the etiology of pediatric bipolar disorder; association with SNPs in the 3' region of the gene
18331164 DAT1 gene was unrelated to visual search or vigilance performance
18331164 Observational study of gene-disease association. (HuGE Navigator)
18327668 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18270970 Observational study of genotype prevalence. (HuGE Navigator)
18239643 Observational study of gene-disease association. (HuGE Navigator)
18216182 These results directly establish the proximity of transmembrane domains 1 and 6 in DAT and suggest that the mechanism of transport inhibition by cocaine involves close interactions with multiple regions of the substrate permeation pathway.
18214865 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18214864 Lack of association of SLC6A3 in a French ADHD sample is reported.
18214864 Observational study of gene-disease association. (HuGE Navigator)
18206700 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18206700 children homozygous for the 10-repeat allele of the common dopamine transporter (DAT1) polymorphism exposed to maternal prenatal smoke exhibited significantly higher hyperactivity-impulsivity than children without these environmental or genetic risks
18197081 Results did not support an association between this polymorphism of the DAT1 gene and conduct disorder in adolescents.
18197081 Observational study of gene-disease association. (HuGE Navigator)
18197080 Observational study of gene-disease association. (HuGE Navigator)
18188752 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18181793 Using a gene-by-environment (G x E) design, we tested whether three polymorphisms in the dopamine transporter gene (DAT1, also referred to as SLC6A3, located at 5p15.33) interacted with maternal parenting to predict first-onset episodes of depression.
18181793 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18174826 DAT1 genotype affected activation in the striatum and cerebellar vermis. The genotype interacted with familial risk of ADHD in the striatum but not the vermis.
18165969 Association of SLC6A3 gene and ADHD symptoms in a Canadian population-based sample of same-age twins is reported.
18165969 Observational study of gene-disease association. (HuGE Navigator)
18094849 results suggest that the intron 8 VNTR of the SLC6A3 investigated in this study is not related to the susceptibility for OCD in a Brazilian sample.
18094849 Observational study of gene-disease association. (HuGE Navigator)
18088380 There is regulation of oligomerization of an the dopamine transporter,(DAT), by substrates that act at DAT. In addition, there is an important linkage between oligomerization of DAT and endocytic or other modulatory mechanisms impacting surface DAT.
18081165 Observational study of gene-disease association. (HuGE Navigator)
18070248 Observational study of gene-disease association. (HuGE Navigator)
18070248 significant role of the 3' part of the DAT1 gene in withdrawal seizures of alcohol-dependent patients
18053732 conclude that it is unlikely that there exist two tropane binding sites in close proximity to one another on either the DAT or SERT.
18046306 Spatial attentional bias correlated with ADHD symptom levels and varied according to DAT1 genotype.
18045777 Variation in SLC6A3 is implicated as risk factor for schizophrenia.
18023044 Observational study of gene-disease association. (HuGE Navigator)
18004640 Comparing with controls, AOA1 patients showed a slight reduction of the average striatal DAT density, which was bilateral and uniform in caudate and putamen.
17979508 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17965994 The VNTR polymorphism of the DAT1-gene modulates NAA/Cho and NAA/Cr in the left putamen independent of psychiatric diagnosis status. These results suggest an association of DAT1 VNTR polymorphism, dopaminergic activity, and neuronal function in putamen
17965994 Observational study of gene-disease association. (HuGE Navigator)
17955458 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17955457 a role of the SLC6A3 genotype in determining the response to methylphenidate in the treatment of adults with ADHD.
17955457 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17948872 did not demonstrate a significant association between methylphenidate treatment response and the polymorphisms DRD4 VNTR, CHRNA4 (rs1044396 and rs6090384) and the long (L(A) and L(G)) and short (S) forms of the serotonin transporter promoter region
17928119 Observational study of gene-disease association. (HuGE Navigator)
17907820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17893706 Observational study of gene-disease association. (HuGE Navigator)
17873367 alpha-Synuclein/dopamine transporter (DAT) protein complex formation accelerates DAT-mediated cellular dopamine (DA) uptake.
17711354 Association of the DAT with lipid microdomains in the plasma membrane and/or the cytoskeleton serves to regulate both the lateral mobility of the transporter and its transport capacity.
17705902 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17704152 biophysical analysis of how dopamine transporter interacts with dopamine
17692827 The present study further explores the structural requirements for the cytotoxic effects of beta-carbolines and searches for additional compounds involved in the pathogenesis of Parkinson's disease.
17690944 functional genetic variation in the dopamine transporter does not act as a significant risk factor for migraine
17690944 Observational study of gene-disease association. (HuGE Navigator)
17689985 Observational study of gene-disease association. (HuGE Navigator)
17689985 our results support a role of DAT variable number of tandem repeat in both brain activation and cognition
17679637 Observational study of gene-disease association. (HuGE Navigator)
17679637 there were no significant effects of the DRD1 or DAT1 polymorphisms on clinical outcome or cortical development.
17671965 Observational study of gene-disease association. (HuGE Navigator)
17671965 3' UTR VNTR of the DAT dopamine transporter is associated with childhood attention deficit hyperactivity disorder
17654295 Clinical trial of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17633563 Observational study of genotype prevalence. (HuGE Navigator)
17621383 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17608284 Observational study of gene-disease association. (HuGE Navigator)
17582621 No association between the dopamine transporter gene 1 10-repeat allele and attention-deficit hyperactivity disorder in the Iranian population
17582621 Observational study of gene-disease association. (HuGE Navigator)
17579611 This study found that SNP rs463379 was significantly associated with ADHD.
17579611 Observational study of gene-disease association. (HuGE Navigator)
17579368 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17579365 VNTR polymorphisms of the human dopamine transporter gene and expression is associated with alzheimer disease
17549062 Observational study of gene-disease association. (HuGE Navigator)
17549062 Healthy children who were homozygous for alleles that influence the expression of dopamine transporters in the brain displayed inattention for left-sided stimuli, whereas heterozygotes did not.
17539957 Observational study of gene-disease association. (HuGE Navigator)
17539957 findings offer no evidence for an association of the DAT(Int8) with migraine with and without aura and therefore do not implicate the dopamine transporter gene as a modifier of migraine risk
17526637 Observational study of gene-disease association. (HuGE Navigator)
17525955 DAT Dopamine Transporter polymorphisms ,an interaction between dopamine receptor D4 protein and DAT genotypes, on inhibitory control
17525955 Observational study of gene-disease association. (HuGE Navigator)
17508996 Meta-analysis of gene-disease association. (HuGE Navigator)
17508996 results support the hypothesis that the DAT1 3'UTR VNTR polymorphism is associated with smoking cessation: meta-analysis
17508355 Observational study of gene-disease association. (HuGE Navigator)
17508355 allele frequencies did not differ between cases and controls, but DAT1 genotype accounted for variations of tic severity within the Tourette syndrome group
17501935 Observational study of gene-disease association. (HuGE Navigator)
17500623 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17485610 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17483451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17466074 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17449559 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17449448 Observational study of gene-disease association. (HuGE Navigator)
17440978 Meta-analysis of gene-disease association. (HuGE Navigator)
17440978 the 10-repeat allele of a VNTR polymorphism in the 3'-UTR the DAT1 gene has a small but significant role in the genetic susceptibility of attention deficit hyperactivity disorder - meta-analysis
17440951 Observational study of gene-disease association. (HuGE Navigator)
17440935 family-based association test showed preferential transmission (P = 0.019) of the 9R allele from parents to ADHD probands
17439486 Data show that valproate treatment significantly increases dopamine transporter gene expression in a Sp transcription factor-dependent manner.
17432702 Observational study of gene-disease association. (HuGE Navigator)
17427194 Observational study of gene-disease association. (HuGE Navigator)
17427187 Observational study of gene-disease association. (HuGE Navigator)
17427187 A haplotype in the 3' untranslated region of DAT1 modifies the effect of lifetime traumatic experience on the severity of nicotine dependence.
17413453 No evidence of common repeat alleles in intron 8 or 3'utr and adult attention deficit and hypersensitivity disorder.
17403983 Observational study of gene-disease association. (HuGE Navigator)
17392738 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17325714 Observational study of gene-disease association. (HuGE Navigator)
17316573 Observational study of gene-disease association. (HuGE Navigator)
17316573 The results confirm and strengthen our preliminary observation that homozygosity for the T-allele is a predisposing factor in male patients, but not in females.
17314918 The current findings have implications for treatment response to drugs currently in use (or being developed) for the treatment of overeating and overweight.
17314918 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17267664 These experiments demonstrate that D(2) receptor (short splice variant, D(2S)R) stimulation increases DAT cell surface expression. Furthermore, they show that the increase in DAT function is ERK1/2-dependent but PI3K-independent.
17264803 Observational study of gene-disease association. (HuGE Navigator)
17260170 A significant reduction of dopamine transporter was found in peripheral blood lymphocytes in Parkinson's disease patients, but not in essential tremor patients.
17255098 Cocaine binding near TM6 may overlap the dopamine translocation pathway and function to inhibit TM6 structural rearrangements necessary for transport
17250655 The present results prompt discussion of models explaining how factors regulating DAT expression at the plasma membrane can regulate DAT function and pharmacology.
17245411 Observational study of gene-disease association. (HuGE Navigator)
17225991 Observational study of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17192955 Observational study of gene-disease association. (HuGE Navigator)
17192955 The inconsistent association between DAT1 and child behavior problems may reflect joint influence of the 10-repeat and 9-repeat alleles.
17191306 Observational study of gene-disease association. (HuGE Navigator)
17191306 Data suggest that DAT1 gene polymorphism may not associated with personality traits in a Korean population.
17187291 Challenge with low-dose apomorphine may therefore be used as an indirect tool to measure the extent of nigrostriatal neurodegeneration in early PD via the dopamine transporter.
17175058 Observational study of gene-disease association. (HuGE Navigator)
17171650 Observational study of gene-disease association. (HuGE Navigator)
17171650 study has identified a significant association between the presence of Tourette syndrome and a DAT polymorphism
17157268 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17150335 Observational study of gene-disease association. (HuGE Navigator)
17135598 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17130883 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17120049 Observational study of gene-disease association. (HuGE Navigator)
17120049 A 40-bp variable number tandem repeat of DAT1 is associated with increase risk of violence or serious delinquency in male adolescents and young adults (ages 12 to 23).
17109713 Observational study of gene-disease association. (HuGE Navigator)
17079728 These data provide the first evidence that the ubiquitin moieties conjugated to DAT may serve as a molecular interface of the transporter interaction with the endocytic machinery.
17063150 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17044101 Observational study of gene-disease association. (HuGE Navigator)
17044101 These results suggest a role for the promoter region of DAT1 gene in attention deficit hyperactivity disorder susceptibility in this Brazilian sample.
17044099 Observational study of gene-disease association. (HuGE Navigator)
17044099 The present study suggests that dopamine candidate genes are associated with increased vulnerability to ADHD in the Han Chinese population.
17042887 Observational study of gene-disease association. (HuGE Navigator)
17042887 no evidence for a major role of the 5'-UTR of the dopamine transporter gene in bipolar affective disorder
17028370 There is an association between DAT1 and DRD4 and increased response variability in ADHD.
17023870 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16963468 Study reveals that allelic variants in SLC6A3, which affect gene expression, are associated with Parkinson's disease in this population and may interact with occupational pesticide exposure to increase PD risk.
16930369 Observational study of gene-disease association. (HuGE Navigator)
16917950 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16917950 An absence of association with DAT1 polymorphism in a sample of adults with ADHD.
16894395 Observational study of gene-disease association. (HuGE Navigator)
16894395 Analysis used within family tests of association in a sample of 776 DSM-IV ADHD combined type cases and found nominal significance with SNPs in DAT1.
16818870 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16783497 Observational study of gene-disease association. (HuGE Navigator)
16783497 our present findings support the genetic involvement of distinct hSLC6A3 genotypes in schizophrenia
16782077 Observational study of gene-disease association. (HuGE Navigator)
16782077 This study examined either allele of the DAT1 core promoter -67 functional polymorphism is associated with ADHD in a case/control study.
16760197 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16741944 Observational study of gene-disease association. (HuGE Navigator)
16741944 The DAT1 40bp VNTR 9/10 polymorphism pairing appears to be reliably associated with greater symptoms of attention deficit hyperactivity disorder and externalizing behavior from childhood to adulthood.
16712949 Observational study of gene-disease association. (HuGE Navigator)
16710758 Cis-acting variation in 5' regions of the human DAT/SLC6A3 locus contributes to individual differences in levels of DAT expression in vivo.
16702979 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16702979 dopamine transporter VNTR polymorphism influenced rapid response to antidepressant therapy.
16674552 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16671078 Measurement of striatal dopamine transporter in Parkinson's disease associated with the LRRK2 mutation.
16623961 Observational study of gene-disease association. (HuGE Navigator)
16611807 Subjects homozygous for the COMT Met allele and the dopamine transporter 10-repeat allele have the most focused response, whereas the COMT Val and the DAT 9-repeat alleles have the least.
16604301 Observational study of gene-disease association. (HuGE Navigator)
16604301 These findings suggest that the variants of 5-HTTLPR interacted with the DAT1 gene polymorphism to influence the HA and RD temperament subscales of TCI.
16585476 Observational study of gene-disease association. (HuGE Navigator)
16569110 Observational study of gene-disease association. (HuGE Navigator)
16545000 Observational study of gene-disease association. (HuGE Navigator)
16537431 Observational study of gene-disease association. (HuGE Navigator)
16537431 DAT1 gene variation may play a role in cocaine dependence etiology
16526040 Observational study of gene-disease association. (HuGE Navigator)
16526026 Data support the role of DAT1 in ADHD susceptibility among Korea population.
16424823 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16406146 Our data suggest a mechanism of 6-OHDA-induced dopaminergic toxicity involving an interaction of mutant alpha-synucleins with the DAT molecule and subsequent acceleration of cellular energy depletion that might be relevant for the pathogenesis of PD.
16402340 Observational study of gene-disease association. (HuGE Navigator)
16402340 VNTR polymorphism of the DAT gene is not associated with attention deficit hyperactivity disorder in Chinese children.
16389711 Meta-analysis of gene-disease association. (HuGE Navigator)
16389200 Observational study of gene-disease association. (HuGE Navigator)
16368111 Observational study of gene-disease association. (HuGE Navigator)
16342279 DAT1 10 allele homozygosity was significantly higher in siblings with attention-deficit/hyperactivity disorder.
16309561 study identified the DAT1 VNTR as a functional polymorphism, affecting ligand binding and DAT density
16261167 Observational study of gene-disease association. (HuGE Navigator)
16261167 This study reports the identification of 20 additional SNPs in DAT1 for a total of 63 variants. It also reports evidence for association to bipolar disorder in a second independent sample of families.
16237680 HIV-1 Nef-mediated downregulation of HLA (MHCI) may be affected by/inhibited by SLC6A3 as demonstrated by siRNA genome-wide screen [in HeLa cells)
16222334 In this sample the DAT1 VNTR did not show association with ADHD.
16216085 results indicate a previously unappreciated role of microtubules in the modulation of DAT trafficking, and provide insight into a novel mechanism by which alpha-synuclein regulates DAT activity, by tethering the transporter to the microtubular network
16201143 Observational study of genotype prevalence. (HuGE Navigator)
16178931 Observational study of gene-disease association. (HuGE Navigator)
16178931 No association between DAT1-10R homozygosity and response to methylphenidate for treatment of ADHD in Dutch sibpairs
16178930 Observational study of gene-disease association. (HuGE Navigator)
16178930 Significant association of the severe combined ADHD subtype with over-transmission of the DAT 440 base pair allele and under-transmission of the 480 base pair allele using population-based ADHD subtypes based on latent class analysis
16171832 This study found evidence of increased DAT variation in African-American subjects as well as in predominantely hyperactive-impulsive probands. And A559V was identified in two Caucasian male siblings with ADHD and 10-repeat 3'VNTR allele.
16168728 Observational study of gene-disease association. (HuGE Navigator)
16168728 Results suggest that the 10-repeat DAT1 allele may mediate neuropsychological impairment in ADHD.
16165273 Observational study of gene-disease association. (HuGE Navigator)
16139170 DAT availability increased by about 40% in a study of brain bioavailability in obsessive compulsisve disorder.
16125912 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16123773 Observational study of gene-disease association. (HuGE Navigator)
16110277 concomitant regulation of alpha-synuclein and dopamine transporter binding and function in human striatal synaptic terminals isolated from cocaine abusers
16109712 PKC-induced DAT ubiquitylation may target DAT to lysosomal degradation
16109590 Observational study of gene-disease association. (HuGE Navigator)
16103889 In a sample of bipolar patients, two rare missense substitutions (A559V and E602G) have been identified. The E602G mutant is not fully functional. The E602G protein is transcribed and translated but not delivered to the cell surface.
16082693 results refute the possibility of the reported DraI endonuclease variation or alleles of variable number of tandem repeats as DAT1 functional variants contributing to the attention-deficit hyperactivity disorder
16082688 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16082688 The 3' variable number of tandem repeats and three additional promoter variants in DAT1 do not appear to be associated with attention deficit disorder with hyperactivity, or response to stimulant mediation
16041244 Observational study of gene-disease association. (HuGE Navigator)
16041244 although DAT (SLC6A3) 5' region SNPs haplotypes significantly alter in vitro transcriptional activity, they are not related to Parkinson's disease risk
15996968 Observational study of gene-disease association. (HuGE Navigator)
15993876 Observational study of gene-disease association. (HuGE Navigator)
15940306 The DAT1 VNTR alleles show haplotype association and linkage disequilibrium in children with attention deficit hyperactivity disorder.
15924135 nonclassical, distinct endocytic signals in the dopamine transporter (DAT) that are necessary and sufficient to drive constitutive and protein kinase C-regulated DAT internalization were identified
15872345 Observational study of gene-disease association. (HuGE Navigator)
15845322 Observational study of gene-disease association. (HuGE Navigator)
15827573 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15823165 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15809660 Observational study of gene-disease association. (HuGE Navigator)
15809660 DAT1 is a QTL for continuously distributed ADHD behaviours in the general population and the cognitive endophenotype of response inhibition.
15768394 Observational study of gene-disease association. (HuGE Navigator)
15763138 Induction of c-Fos by dopamine and norepinephrine requires the presence of hDAT and hNET but the contributions of hDAT and hNET to c-Fos induction is distinguishable on the basis of differing responses to a PKC inhibitor.
15724142 Observational study of gene-disease association. (HuGE Navigator)
15724142 The DAT1 gene, a gene expressed predominantly in the basal ganglia, preferentially influences caudate volume in a sample of subjects including subjects with ADHD, their unaffected siblings, and healthy controls.
15722958 10-repeat allele of the DAT gene has at most a minor role in the genetic susceptibility to attention deficity hyperactivity disorder.
15708296 Age-related cognitive deficits were mediated by reductions in DAT binding, whereas DAT binding added systematic cognitive variance after controlling for age.
15683546 VNTR polymorphism may not have a direct effect on DAT1 expression and the associations observed with psychiatric phenotypes may be mediated via linkage disequilibrium with other functional polymorphisms.
15608954 Observational study of gene-disease association. (HuGE Navigator)
15605097 Observational study of gene-disease association. (HuGE Navigator)
15602501 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15602501 Effect of amphetamine based on DAT1 3'-untranslated region VNTR polymorphism.
15567077 Meta-analysis of gene-disease association. (HuGE Navigator)
15542698 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15492001 studies suggest that parkin increases dopamine uptake by enhancing the ubiquitination and degradation of misfolded dopamine transporter (DAT)
15381926 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15380858 Observational study of gene-disease association. (HuGE Navigator)
15370155 Meta-analysis of gene-disease association. (HuGE Navigator)
15274029 Observational study of gene-disease association. (HuGE Navigator)
15229055 Observational study of gene-disease association. (HuGE Navigator)
15211638 Observational study of gene-disease association. (HuGE Navigator)
15211638 long-repeat alleles of DRD4 (ranging from 4 to 6 repeats) and DAT1 (ranging from 11 to 12 repeats), were present more frequently in attention deficit hyperactivity disorder probands than controls
15210531 Significant reductions in dopamine transporter occur in the caudate and anterior and posterior putamens in subjects with Lewy body dementia compared with subjects with Alzheimer disease and controls.
15202772 Terminal region interacts with syntaxin 1a and RACK1.
15193761 Observational study of gene-disease association. (HuGE Navigator)
15193761 The A9 allele of the DAT gene is involved in vulnerability to alcohol withdrawal complications in women, but these complications differ from those associated with this polymorphism in alcohol-dependent men.
15190232 Observational study of gene-disease association. (HuGE Navigator)
15148564 Observational study of gene-disease association. (HuGE Navigator)
15135042 dopamine transporter (DAT) function requires alpha-synuclein (review)
15094788 Observational study of gene-disease association. (HuGE Navigator)
15091313 Observational study of gene-disease association. (HuGE Navigator)
15091313 No significant associations were found between DAT polymorphism in genotype & allele frequency & clinical outcome of MAP abusers. The biological relevance of the VNTR polymorphism in the 3'-untranslated region in MAP abusers was not demonstrated.
15069467 Observational study of gene-disease association. (HuGE Navigator)
15024426 N-terminal phosphorylation of the dopamine transporter is required for amphetamine-induced efflux
15024013 Non-glycosylated DAT at the cell surface displays appreciably reduced catalytic activity and altered inhibitor sensitivity compared with wild type.
14978671 These findings are in broad agreement with other studies of the expression of alpha-synuclein mRNA in human brain and suggest that Lewy body formation is unlikely to be the result of overexpression of alpha-synuclein.
14732864 Significantly stronger stress-induced cigarette craving is found in individuals carrying the SLC6A3 nine-repeat allelic variant compared to those without the allelic variant.
14732464 No differences are found between hallucinators with Parkinson's disease (PD)and non-hallucinators with PD in either the genotypic or allelic distributions.
14685824 There may be an interactive effect between the SLC6A3 and early smoking onset on modulating the susceptibility of nicotine dependence
14681904 Observational study of gene-disease association. (HuGE Navigator)
14660644 dopamine transporter residue aspartate 345 is critical for conformational changes in substrate translocation and cocaine binding
14597628 the dopamine transporter has intracellular residues critical for regulation of transporter conformation and cocaine binding
14584093 Observational study of gene-disease association. (HuGE Navigator)
14570538 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14519759 dopamine transporter forms a tetramer in the plasma membrane
12947560 Observational study of gene-disease association. (HuGE Navigator)
12931138 Observational study of gene-disease association. (HuGE Navigator)
12915833 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12898575 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12898575 The 10-repeat DAT1 risk allele is associated with medication response, may help to predict positive clinical outcome in attention deficit hyperactivity disorder
12874502 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12815660 Observational study of gene-disease association. (HuGE Navigator)
12773538 function of the TM7/8 region with the occurrence of distinct Na+-, substrate-, and perhaps inhibitor-induced conformational changes critical for the proper function of the transporter.
12740596 DAT1 VNTR polymorphism is associated with attention-deficit hyperactivity disease in a Taiwanese sample.
12708251 Observational study of genotype prevalence. (HuGE Navigator)
12707943 Observational study of gene-disease association. (HuGE Navigator)
12707931 Observational study of gene-disease association. (HuGE Navigator)
12686408 Observational study of gene-disease association. (HuGE Navigator)
12686408 The homozygote 10-copy genotype of the VNTR polymorphism within the DAT may confer protection against Parkinson disease for male, but not for female patients
12660802 confirmed the DAT1 association with attention deficit disorder with hyperactivity
12658362 Observational study of gene-disease association. (HuGE Navigator)
12658362 No significant difference was demonstrated for genotype or allele frequency, when comparing methamphetamine dependent and control cases for dopamine transporter polymorphisms.
12650952 Observational study of gene-disease association. (HuGE Navigator)
12630565 Review. DAT1 gene has a VNTR polymorphism in the 3'-untranslated region of the mRNA, which changes its gene expression. DAT1 polymorphisms are good candidates for etiological involvement in various psychiatric conditions.
12605102 Observational study of gene-disease association. (HuGE Navigator)
12605102 An association analysis for dopamine transporter polymorphism and p300 component in normal young women is negative.
12579508 Observational study of gene-disease association. (HuGE Navigator)
12513948 Observational study of gene-disease association. (HuGE Navigator)
12490667 Observational study of gene-disease association. (HuGE Navigator)
12490667 results suggest that variants of the dopamine transporter gene may be related to obesity in African-American smokers
12465073 Observational study of gene-disease association. (HuGE Navigator)
12464618 the major phosphorylation sites in DAT are within the distal N terminus, which contains several serines
12459514 Neonatal 6-hydroxydopamine lesion induced Slc6a3 express in young adult rats is in good agreement with in ADHD patients
12457396 Measured DAT1 mRNA levels in brain and lymphocytes. Observed that increased levels of DAT1 expression were associated with the number of 10-repeat alleles of the 3'UTR VNTR polymorphism.
12453630 The VNTR region was highly variable among the primates, intra-species variation also found in the chimpanizees and cynomolgus macaques.
12429746 assembly of DAT monomers plays a critical role in the expression and function of the dopamine transporter
12422069 Observational study of gene-disease association. (HuGE Navigator)
12422069 the dopamine transporter (DAT) polymorphism (1215A/G) does not play a major role in the susceptibility to Parkinson's disease
12401557 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12401557 The 3'UTR of the DAT1 gene affects vulnerability to severe alcohol withdrawal.
12232785 Observational study of gene-disease association. (HuGE Navigator)
12232785 association of the dopamine transporter (DAT) SLC6A3 3' variable number tandem repeat (VNTR) polymorphism with post traumatic stress disorder
12215242 Observational study of gene-disease association. (HuGE Navigator)
12215242 The dopamine transporter (DAT) gene (SLC6A3) encodes a protein that regulates synaptic levels of dopamine in the brain and is a candidate gene for addictive behaviors
12210886 Observational study of gene-disease association. (HuGE Navigator)
12173460 Observational study of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
12173460 VNTR polymorphisms in male opiate addicts
12172219 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12172219 There is an association between homozygosity for the 10-repeat allele at dopamine transporter gene locus and poor response to MPH.
12149916 Lack of association between VNTR polymorphism of DAT gene and schizophrenia.
11989984 findings indicate CFT(2beta-carbomethoxy-3beta-(4-fluorophenyl)tropane)binding requires DAT sequences in the regions encompassing the 3rd and 6-8th transmembrane domain;these regions might contribute to form the 3-dimensional pocket for CFT binding.
11959130 Conventional protein kinase C isoforms regulate human dopamine transporter activity in Xenopus oocytes.
11911442 variable number of tandem repeat polymorphism affects the expression of the dopamine transporter DAT1
11834311 Observational study of gene-disease association. (HuGE Navigator)
11820798 Cocaine-induced increases in cell surface expression of dopamine transporter and associated changes in dopamine clearance represent a novel mechanism that may play a role in its addictive properties.
11807408 Observational study of gene-disease association. (HuGE Navigator)
11807408 results suggest that both the DRD2 promoter region and the DAT gene do not play a significant role in conferring vulnerability to alcoholism (Dopamine Transporter DAT)
11803445 Variability in the length or the sequence of the 3'-UTR of the DAT gene may influence levels of DAT protein in the brain.
11803442 DAT variation in humans links robustly with variation in both baseline and/or psychostimulant-induced locomotion.
11798784 Observational study of gene-disease association. (HuGE Navigator)
11774209 Observational study of gene-disease association. (HuGE Navigator)
11558224 Observational study of genotype prevalence. (HuGE Navigator)
11505915 Uncategorized study of gene-disease association. (HuGE Navigator)
11449401 Observational study of gene-disease association. (HuGE Navigator)
11378848 Observational study of gene-disease association. (HuGE Navigator)
11244477 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11220753 Observational study of gene-disease association. (HuGE Navigator)
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11104840 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11104840 A VNTR polymorphism in this gene is not associated with schizophrenia or with therapeutic response to typical neuroleptics in schizophrenic patients

AA Sequence

MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFL      1 - 70
LSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKG     71 - 140
VGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGT    141 - 210
TPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTAL    211 - 280
LLRGVTLPGAIDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTT    281 - 350
SINSLTSFSSGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI    351 - 420
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLI    421 - 490
EAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGAYIFPDWANAL    491 - 560
GWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQFTLRHWLKV              561 - 620
//

Text Mined References (704)

PMID Year Title
27167478 2016 [Self-rated Caffeine Sensitivity: Implications for Personalized Sleep Medicine?].
26986136 2016 The Association Between Genetic Variants in the Dopaminergic System and Posttraumatic Stress Disorder: A Meta-Analysis.
26831905 2016 Identification of the dopamine transporter SLC6A3 as a biomarker for patients with renal cell carcinoma.
26786096 2016 Differential Internalization Rates and Postendocytic Sorting of the Norepinephrine and Dopamine Transporters Are Controlled by Structural Elements in the N Termini.
26621748 2015 Ack1 is a dopamine transporter endocytic brake that rescues a trafficking-dysregulated ADHD coding variant.
26593110 2016 Meta-analysis of the association of the SLC6A3 3'-UTR VNTR with cognition.
26504078 2015 Dual Action of Zn2+ on the Transport Cycle of the Dopamine Transporter.
26478196 2015 Genetic Similarities between Compulsive Overeating and Addiction Phenotypes: A Case for "Food Addiction"?
26471374 2015 Genetic contributions to attentional response time slopes across repeated trials.
26442590 2015 Dopamine Transporter Activity Is Modulated by ?-Synuclein.
26342565 2015 DRD2 and SLC6A3 moderate impact of maternal depressive symptoms on infant cortisol.
26305376 2015 A Physical Interaction between the Dopamine Transporter and DJ-1 Facilitates Increased Dopamine Reuptake.
26255829 2015 Spontaneous inward opening of the dopamine transporter is triggered by PIP2-regulated dynamics of the N-terminus.
26245713 2015 Association of COMT and SLC6A3 polymorphisms with impulsivity, response inhibition and brain function.
26206710 2015 Cortical thickness differences in the prefrontal cortex in children and adolescents with ADHD in relation to dopamine transporter (DAT1) genotype.
26160290 2015 Promoter Methylation and BDNF and DAT1 Gene Expression Profiles in Patients with Drug Addiction.
26149737 2016 Meta-analysis reveals significant association of 3'-UTR VNTR in SLC6A3 with smoking cessation in Caucasian populations.
26120847 2015 Reduced Dopamine Transporter Availability and Neurocognitive Deficits in Male Patients with Alcohol Dependence.
26096461 2015 Longitudinal changes of dopamine transporters in heroin users during abstinence.
26073896 2015 Influence of DAT1 and COMT variants on neural activation during response inhibition in adolescents with attention-deficit/hyperactivity disorder and healthy controls.
26058807 2015 A 40-bp VNTR polymorphism in the 3'-untranslated region of DAT1/SLC6A3 is associated with ADHD but not with alcoholism.
26048990 2015 Ctr9, a Protein in the Transcription Complex Paf1, Regulates Dopamine Transporter Activity at the Plasma Membrane.
26041607 2015 Serotonin and Dopamine Candidate Gene Variants and Alcohol- and Non-Alcohol-Related Aggression.
26006708 2015 Externalizing Problem Behavior in Adolescence: Dopaminergic Genes in Interaction with Peer Acceptance and Rejection.
25963949 2015 Epigenetic Regulation of Dopamine Transporter mRNA Expression in Human Neuroblastoma Cells.
25924976 2016 Predicting childhood effortful control from interactions between early parenting quality and children's dopamine transporter gene haplotypes.
25915480 2015 Association between the dopamine transporter gene (DAT1) and attention deficit hyperactivity disorder-related traits in healthy adults.
25862379 2015 DAT1 methylation changes in alcohol-dependent individuals vs. controls.
25850966 2015 Genetic variation of the dopamine transporter (DAT1) influences the acute subjective responses to cocaine in volunteers with cocaine use disorders.
25850298 [The 3'-UTR polymorphism of dopamine transporter gene in hadza and datoga males].
25840828 2015 Multiple epigenetic factors predict the attention deficit/hyperactivity disorder among the Chinese Han children.
25805645 2015 Polymorphism of the dopamine transporter type 1 gene modifies the treatment response in Parkinson's disease.
25804664 2015 Brain dopaminergic system related genetic variability interacts with target/mask timing in metacontrast masking.
25753457 2015 Apathy and striatal dopamine transporter levels in de-novo, untreated Parkinson's disease patients.
25747272 2015 Single-quantum-dot tracking reveals altered membrane dynamics of an attention-deficit/hyperactivity-disorder-derived dopamine transporter coding variant.
25695767 2015 Molecular mechanism of HIV-1 Tat interacting with human dopamine transporter.
25687785 2015 Association of VNTR polymorphisms in DRD4, 5-HTT and DAT1 genes with obesity.
25684044 2015 Association study of the SLC6A3 VNTR (DAT) and DRD2/ANKK1 Taq1A polymorphisms with alcohol dependence in a population from northeastern Brazil.
25683821 2015 The dopamine transporter gene may not contribute to susceptibility and the specific personality traits of amphetamine dependence.
25656446 2015 Changes in the methylation status of DAT, SERT, and MeCP2 gene promoters in the blood cell in families exposed to alcohol during the periconceptional period.
25656223 2015 An association between a dopamine transporter gene (SLC6A3) haplotype and ADHD symptom measures in nonclinical adults.
25617181 2015 A genetic-demographic approach reveals a gender-specific association of SLC6A3/DAT1 40 bp-VNTR with life-expectancy.
25555995 2015 DAT1 and DRD4 genes involved in key dimensions of adult ADHD.
25547317 2015 Dopamine transporter gene may be associated with bipolar disorder and its personality traits.
25526961 2014 Genetic influence of dopamine receptor, dopamine transporter, and nicotine metabolism on smoking cessation and nicotine dependence in a Japanese population.
25496873 2015 Carriers of a common variant in the dopamine transporter gene have greater dementia risk, cognitive decline, and faster ventricular expansion.
25468771 2015 Detection of auto-antibodies to DAT in the serum: interactions with DAT genotype and psycho-stimulant therapy for ADHD.
25439653 2016 Reduced striatal dopamine transporter density associated with working memory deficits in opioid-dependent male subjects: a SPECT study.
25411502 2014 Dopamine transporter genotype is associated with a lateralized resistance to distraction during attention selection.
25339174 2014 A conserved salt bridge between transmembrane segments 1 and 10 constitutes an extracellular gate in the dopamine transporter.
25331903 2014 The rare DAT coding variant Val559 perturbs DA neuron function, changes behavior, and alters in vivo responses to psychostimulants.
25313507 2014 SLC6A3 coding variant Ala559Val found in two autism probands alters dopamine transporter function and trafficking.
25271118 2015 Symptoms of attention-deficit hyperactivity disorder, nonsyndromic orofacial cleft children, and dopamine polymorphisms: a pilot study.
25247548 2014 Crack cocaine users show differences in genotype frequencies of the 3' UTR variable number of tandem repeats of the dopamine transporter gene (DAT1/SLC6A3).
25237117 2014 Dopamine DRD2/ANKK1 Taq1A and DAT1 VNTR polymorphisms are associated with a cognitive flexibility profile in pathological gamblers.
25212851 2014 Dopamine transporter SLC6A3 genotype affects cortico-striatal activity of set-shifts in Parkinson's disease.
25179220 2014 Computational and biochemical docking of the irreversible cocaine analog RTI 82 directly demonstrates ligand positioning in the dopamine transporter central substrate-binding site.
25130782 2014 Association between the 9 repeat allele of the dopamine transporter 40bp variable tandem repeat polymorphism and Alzheimer's disease.
25109468 2014 Dopamine transporter imaging using 99mTc-TRODAT-1 SPECT in Parkinson's disease.
25093598 2014 Association between amygdala reactivity and a dopamine transporter gene polymorphism.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
25038551 2014 Dopamine system genes are associated with orienting bias among healthy individuals.
25019689 2014 No association of SLC6A3 and SLC6A4 gene polymorphisms with schizophrenia in the Han Chinese population.
24946437 [The analysis of the polymorphic variations of the dopamine gen transporter (DAT1) and the serotonin transporter (5-HTTLPR) in patients with alcohol dependence syndrome with inclusion of the phenotypic feature of sweet liking preference].
24929324 2015 Differential susceptibility to maternal expressed emotion in children with ADHD and their siblings? Investigating plasticity genes, prosocial and antisocial behaviour.
24911152 2014 Missense dopamine transporter mutations associate with adult parkinsonism and ADHD.
24889756 2014 Preliminary investigation of the influence of dopamine regulating genes on social working memory.
24849661 2014 The influence of genetic variants on striatal dopamine transporter and D2 receptor binding after TBI.
24824713 2014 Polymorphism of dopamine transporter gene DAT1 and individual variability of defense cardiac response in humans.
24780147 2014 Association of dopamine gene variants, emotion dysregulation and ADHD in autism spectrum disorder.
24753048 2014 An N-terminal threonine mutation produces an efflux-favorable, sodium-primed conformation of the human dopamine transporter.
24723432 2014 Lack of influence of DAT1 and DRD2 gene variants on antidepressant response in generalized anxiety disorder.
24708432 2014 Polymorphisms of COMT Val158Met and DAT1 3'-UTR VNTR in illicit drug use and drug-related psychiatric disorders.
24696011 2014 A short review on the relation between the dopamine transporter 10/10-repeat allele and ADHD: implications for HIV infection.
24680725 2014 Treatment-resistant schizophrenia and DAT and SERT polymorphisms.
24657591 2014 Genetic variations in dopamine and inhibitory control: lack of influence on action restraint.
24633632 2014 Sequence variants in SLC6A3, DRD2, and BDNF genes and time to levodopa-induced dyskinesias in Parkinson's disease.
24625311 2014 Genetic polymorphisms of DAT1 and COMT differentially associate with actigraphy-derived sleep-wake cycles in young adults.
24613933 2014 Dopamine transporter deficiency syndrome: phenotypic spectrum from infancy to adulthood.
24521003 2014 Genetics of preparation and response control in ADHD: the role of DRD4 and DAT1.
24487615 2014 Further evidence for the association between a polymorphism in the promoter region of SLC6A3/DAT1 and ADHD: findings from a sample of adults.
24461309 2015 Evidence of an association between 10/10 genotype of DAT1 and endophenotypes of attention deficit/hyperactivity disorder.
24439516 2014 Lower availability of midbrain serotonin transporter between healthy subjects with and without a family history of major depressive disorder - a preliminary two-ligand SPECT study.
24403155 2014 Dopaminergic role in regulating neurophysiological markers of sleep homeostasis in humans.
24274990 2014 Association between gene variants and response to buprenorphine maintenance treatment.
24211691 2014 SLC6A3 is a risk factor for Parkinson's disease: a meta-analysis of sixteen years' studies.
24193094 2013 Aggression and polymorphisms in AR, DAT1, DRD2, and COMT genes in Datoga pastoralists of Tanzania.
24086483 2013 Identification of the mRNA expression status of the dopamine D2 receptor and dopamine transporter in peripheral blood lymphocytes of schizophrenia patients.
24078578 2013 [Family-based association study of a variable number of tandem repeat polymorphism of DAT1 gene with Tourette syndrome in a Chinese Han population].
24064458 Do dopamine gene variants and prenatal smoking interactively predict youth externalizing behavior?
24061496 2014 Functional effects of dopamine transporter gene genotypes on in vivo dopamine transporter functioning: a meta-analysis.
24057505 2013 Increases in CSF dopamine in HIV patients are due to the dopamine transporter 10/10-repeat allele which is more frequent in HIV-infected individuals.
24035787 2013 Effects of aging and dopamine genotypes on the emergence of explicit memory during sequence learning.
24024899 2013 Human dopamine transporter gene: differential regulation of 18-kb haplotypes.
24008096 2014 Association between the DAT1 gene and spatial working memory in attention deficit hyperactivity disorder.
23987116 2013 Pesticide-induced gene mutations and Parkinson disease risk: a meta-analysis.
23979605 2013 De novo mutation in the dopamine transporter gene associates dopamine dysfunction with autism spectrum disorder.
23968837 2015 Resting-state striato-frontal functional connectivity is sensitive to DAT1 genotype and predicts executive function.
23963056 2013 The association study of polymorphisms in DAT, DRD2, and COMT genes and acute extrapyramidal adverse effects in male schizophrenic patients treated with haloperidol.
23911780 2013 DAT genotype modulates striatal processing and long-term memory for items associated with reward and punishment.
23861813 2013 DAT1 polymorphism determines L-DOPA effects on learning about others' prosociality.
23808292 2013 [Genetic markers for trait anxiety as one of the risk factors for cardiovascular diseases (WHO-MONICA program, MONICA-psychosocial subprogram)].
23761898 2013 Gene x abstinence effects on drug cue reactivity in addiction: multimodal evidence.
23731290 2014 Relating dopaminergic and cholinergic polymorphisms to spatial attention in infancy.
23704939 2013 Dopamine transporter genotype dependent effects of apomorphine on cold pain tolerance in healthy volunteers.
23681294 2013 Dopamine, norepinephrine, and the management of sensorimotor bindings: individual differences in updating of stimulus-response episodes are predicted by DAT1, but not DBH5'-ins/del.
23653272 2013 Correlations between polymorphisms in genes coding elements of dopaminergic pathways and body mass index in overweight and obese women.
23647133 2013 The association of a novel haplotype in the dopamine transporter with preschool age posttraumatic stress disorder.
23645138 2013 Mutation of tyrosine 470 of human dopamine transporter is critical for HIV-1 Tat-induced inhibition of dopamine transport and transporter conformational transitions.
23637880 2013 Smoking-specific parenting and smoking onset in adolescence: the role of genes from the dopaminergic system (DRD2, DRD4, DAT1 genotypes).
23588108 2014 Meta-analysis of the association between dopamine transporter genotype and response to methylphenidate treatment in ADHD.
23541676 2013 Neurocognitive effects of methylphenidate on ADHD children with different DAT genotypes: a longitudinal open label trial.
23527493 2013 The genetic precursors and the advantageous and disadvantageous sequelae of inhibited temperament: an evolutionary perspective.
23524636 2013 No changes in striatal dopamine transporter in antidepressant-treated patients with major depression.
23398760 2013 Child dopamine active transporter 1 genotype and parenting: evidence for evocative gene-environment correlations.
23363412 2013 Dopaminergic gene polymorphisms affect long-term forgetting in old age: further support for the magnification hypothesis.
23340505 2013 Dopamine transporter DAT and receptor DRD2 variants affect risk of lethal cocaine abuse: a gene-gene-environment interaction.
23273726 2013 Functional genomics of attention-deficit/hyperactivity disorder (ADHD) risk alleles on dopamine transporter binding in ADHD and healthy control subjects.
23255304 2013 Association of dopamine transporter gene variants with childhood ADHD features in bipolar disorder.
23215821 2013 Gene-environment interaction in externalizing problems among adolescents: evidence from the Pelotas 1993 Birth Cohort Study.
23185343 2012 Dopamine D1, D2, D3 receptors, vesicular monoamine transporter type-2 (VMAT2) and dopamine transporter (DAT) densities in aged human brain.
23161550 2013 Phosphorylation of dopamine transporter serine 7 modulates cocaine analog binding.
23153115 2013 Interaction of dopamine transporter gene and observed parenting behaviors on attention-deficit/hyperactivity disorder: a structural equation modeling approach.
23137414 2013 Sleep disorders in Machado-Joseph disease: a dopamine transporter imaging study.
23128675 2013 Genetic analysis of polymorphisms in dopamine receptor and transporter genes for association with smoking among cancer patients.
23076524 2012 Association study between the dopamine-related candidate gene polymorphisms and ADHD among Saudi Arabia population via PCR technique.
23065263 2012 DNA methylation and expression profiles of the brain-derived neurotrophic factor (BDNF) and dopamine transporter (DAT1) genes in patients with schizophrenia.
23061530 2014 Neural correlates of attentional bias for smoking cues: modulation by variance in the dopamine transporter gene.
23034259 Association analysis of dopaminergic gene variants (Comt, Drd4 And Dat1) with Alzheimer s disease.
23032071 2013 Interacting effects of naltrexone and OPRM1 and DAT1 variation on the neural response to alcohol cues.
22958175 2012 Association of dopamine-related gene alleles, smoking behavior and decline in FEV1 in subjects with COPD: findings from the lung health study.
22940645 2012 Dopamine transporter genotype predicts attentional asymmetry in healthy adults.
22939506 2013 Aging magnifies the effects of dopamine transporter and D2 receptor genes on backward serial memory.
22930791 2015 Intratask Variability As a Correlate for DRD4 and SLC6A3 Variants: A Pilot Study in ADHD.
22844499 2012 Time-resolved influences of functional DAT1 and COMT variants on visual perception and post-processing.
22832428 2011 Empirical support for an involvement of the mesostriatal dopamine system in human fear extinction.
22819977 2012 The androgen receptor facilitates inhibition of human dopamine transporter (DAT1) reporter gene expression by HESR1 and HESR2 via the variable number of tandem repeats.
22810728 2012 Genetic polymorphisms of the dopamine and serotonin systems modulate the neurophysiological response to feedback and risk taking in healthy humans.
22778840 2010 Akt-dependent and isoform-specific regulation of dopamine transporter cell surface expression.
22749356 2013 The dopamine transporter haplotype and reward-related striatal responses in adult ADHD.
22745713 2012 Molecular variation at the SLC6A3 locus predicts lifetime risk of PTSD in the Detroit Neighborhood Health Study.
22733030 2012 Dopamine-system genes, childhood abuse, and clinical manifestations in women with Bulimia-Spectrum Disorders.
22723947 2012 DAT1 polymorphism is associated with risk taking in the Balloon Analogue Risk Task (BART).
22711722 2012 Serotonin transporter role in identifying similarities between SIDS and idiopathic ALTE.
22698582 2012 DRD2/ANKK1 TaqIA and SLC6A3 VNTR polymorphisms in alcohol dependence: association and gene-gene interaction study in a population of Central Italy.
22691013 Dopamine transporter (DAT1) VNTR polymorphism and alcoholism in two culturally different populations of south India.
22689927 2012 Quantification of dopamine transporter in human brain using PET with 18F-FE-PE2I.
22683321 2012 Epistatic interactions implicating dopaminergic genes in bulimia nervosa (BN): relationships to eating- and personality-related psychopathology.
22682503 2012 Additive effects of the dopamine D2 receptor and dopamine transporter genes on the error-related negativity in young children.
22646917 2012 Interaction of dopamine transporter (DAT1) genotype and maltreatment for ADHD: a latent class analysis.
22564179 2012 Double dissociation between lab measures of inattention and impulsivity and the dopamine transporter gene (DAT1) and dopamine D4 receptor gene (DRD4).
22551036 2012 Naltrexone modification of drinking effects in a subacute treatment and bar-lab paradigm: influence of OPRM1 and dopamine transporter (SLC6A3) genes.
22514303 2012 Attention deficit/hyperactivity disorder-derived coding variation in the dopamine transporter disrupts microdomain targeting and trafficking regulation.
22494359 2012 Dopamine transporter polymorphisms affect social approach-avoidance tendencies.
22454241 2012 Genetic polymorphisms of 5-HTT and DAT but not COMT differentially affect verbal and visuospatial working memory functioning.
22438994 2012 Dopaminergic polymorphisms associated with time-on-task declines and fatigue in the Psychomotor Vigilance Test.
22438288 2013 Interaction between effects of genes coding for dopamine and glutamate transmission on striatal and parahippocampal function.
22435397 2012 Increased striatal dopamine transporter density in moderately severe old restless legs syndrome patients.
22427685 2012 Association tests of striatal DAT availability and SNPs that impact a novel splice variant in the DAT gene.
22408582 2011 Generational association studies of dopaminergic genes in reward deficiency syndrome (RDS) subjects: selecting appropriate phenotypes for reward dependence behaviors.
22366190 2012 Association of intron 1 variants of the dopamine transporter gene with schizophrenia.
22342155 2012 Association between temperament in terms of the Regulative Theory of Temperament and DRD4 and DAT1 gene polymorphisms.
22279524 2012 Genetic mapping and exome sequencing identify variants associated with five novel diseases.
22182296 2012 Dopamine transporter gene moderates response to behavioral parent training in children with ADHD: a pilot study.
22177721 2012 Centrosomal aggregates and Golgi fragmentation disrupt vesicular trafficking of DAT.
22163275 2011 Redistribution of DAT/?-synuclein complexes visualized by "in situ" proximity ligation assay in transgenic mice modelling early Parkinson's disease.
22162768 2011 Dopamine transporter (DAT1) and dopamine receptor D4 (DRD4) genotypes differentially impact on electrophysiological correlates of error processing.
22160470 2012 Identification of an intronic cis-acting element in the human dopamine transporter gene.
22157025 2012 Smoking, dopamine transporter, and hand tremor.
22156764 2013 Striatal dopamine transporter availability in drug-naive patients with schizophrenia: a case-control SPECT study with [(99m)Tc]-TRODAT-1 and a meta-analysis.
22138326 2012 The association of 5-HTR2A-1438A/G, COMTVal158Met, MAOA-LPR, DATVNTR and 5-HTTVNTR gene polymorphisms and antisocial personality disorder in male heroin-dependent Chinese subjects.
22119468 2012 (±)-2-(N-tert-Butylamino)-3'-[(125)I]-iodo-4'-azidopropiophenone: a dopamine transporter and nicotinic acetylcholine receptor photoaffinity ligand based on bupropion (Wellbutrin, Zyban).
22113132 2012 Role of genetic polymorphisms of the dopaminergic system in Parkinson's disease patients with impulse control disorders.
22103304 2012 Dopamine, working memory, and training induced plasticity: implications for developmental research.
22082040 2012 Functional polymorphisms in dopamine-related genes: effect on neurocognitive functioning in HIV+ adults.
22081881 2012 Dopaminergic polymorphisms and educational achievement: results from a longitudinal sample of Americans.
22047966 2012 Effect of dopamine transporter genotype on intrinsic functional connectivity depends on cognitive state.
22026501 2014 Ventral midbrain correlation between genetic variation and expression of the dopamine transporter gene in cocaine-abusing versus non-abusing subjects.
22006250 2011 Differential expression of neuronal dopamine and serotonin transporters DAT and SERT in megakaryocytes and platelets generated from human MEG-01 megakaryoblasts.
21990355 2011 ?-Synuclein stimulates a dopamine transporter-dependent chloride current and modulates the activity of the transporter.
21957239 2011 The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking.
21889247 2011 Association of the DAT1 genotype with inattentive behavior is mediated by reading ability in a general population sample.
21883027 2012 Pupillometry and 123I-DaTSCAN imaging in Parkinson's disease: a comparison study.
21876545 2012 Dopamine transporter genotype predicts behavioural and neural measures of response inhibition.
21873779 2011 Dopamine metabolism-related gene polymorphisms in Roma (Gypsy) and Hungarian populations.
21826203 2011 Genotype and ancestry modulate brain's DAT availability in healthy humans.
21812871 2012 Striatal and extrastriatal dopamine transporter in cannabis and tobacco addiction: a high-resolution PET study.
21802993 2011 Serial dopamine transporter imaging of nigrostriatal function in patients with idiopathic rapid-eye-movement sleep behaviour disorder: a prospective study.
21801841 2012 Imaging genetics for utility of risks over gains and losses.
21799208 2012 Modulation of inhibition of return by the dopamine D2 receptor agonist bromocriptine depends on individual DAT1 genotype.
21716015 2011 Attention deficit/hyperactivity disorder: is there a correlation between dopamine transporter density and cerebral blood flow?
21672565 2011 Dopamine polymorphisms and depressive symptoms predict foods intake. Results from a nationally representative sample.
21644994 2011 Dopamine release mediated by the dopamine transporter, facts and consequences.
21609749 2011 Role of functional dopaminergic gene polymorphisms in the etiology of idiopathic intellectual disability.
21596533 2011 Relationship of DAT1 and adult ADHD to task-positive and task-negative working memory networks.
21595008 2011 Exploring DRD4 and its interaction with SLC6A3 as possible risk factors for adult ADHD: a meta-analysis in four European populations.
21554332 2011 The association between the SLC6A3 VNTR 9-repeat allele and alcoholism-a meta-analysis.
21525861 2011 Dopamine transporter gene variant affecting expression in human brain is associated with bipolar disorder.
21516943 Search for association between suicide and 5-HTT, MAOA and DAT polymorphism in Polish males.
21491204 2011 Candidate-gene approach in posttraumatic stress disorder after urban violence: association analysis of the genes encoding serotonin transporter, dopamine transporter, and BDNF.
21445667 2011 Variation in genes involved in dopamine clearance influence the startle response in older adults.
21404331 2011 Relationship between SLC6A3 genotype and striatal dopamine transporter availability: a meta-analysis of human single photon emission computed tomography studies.
21399631 2011 Flotillin-1 is essential for PKC-triggered endocytosis and membrane microdomain localization of DAT.
21354244 2011 The role of dopamine transporter (SLC6A3) and dopamine D2 receptor/ankyrin repeat and kinase domain containing 1 (DRD2/ANKK1) gene polymorphisms in personality traits.
21304140 2011 SPECT imaging of dopamine transporters with (99m)Tc-TRODAT-1 in major depression and Parkinson's disease.
21299752 2011 Dopamine transporter genotype modulation of neural responses to smoking cues: confirmation in a new cohort.
21298009 2011 The substrate-driven transition to an inward-facing conformation in the functional mechanism of the dopamine transporter.
21295544 2011 Modulation of the dopamine transporter by interaction with Secretory Carrier Membrane Protein 2.
21290414 2011 Differential effects of the HESR/HEY transcription factor family on dopamine transporter reporter gene expression via variable number of tandem repeats.
21272388 2011 Effects of two dopamine-modulating genes (DAT1 9/10 and COMT Val/Met) on n-back working memory performance in healthy volunteers.
21247255 2012 Dopaminergic system genes in childhood aggression: possible role for DRD2.
21232548 2011 fMRI activation during response inhibition and error processing: the role of the DAT1 gene in typically developing adolescents and those diagnosed with ADHD.
21207241 2011 A family based association study of DRD4, DAT1, and 5HTT and continuous traits of attention-deficit hyperactivity disorder.
21179162 2010 A population-specific HTR2B stop codon predisposes to severe impulsivity.
21176997 2012 Striatal dopamine transporter binding correlates with serum BDNF levels in patients with striatal dopaminergic neurodegeneration.
21171728 2011 Interactions between early parenting and a polymorphism of the child's dopamine transporter gene in predicting future child conduct disorder symptoms.
21150814 2011 Association study of the dopamine transporter gene with personality traits and major depressive disorder in the Han Chinese population.
21149640 2011 Site-directed mutations near transmembrane domain 1 alter conformation and function of norepinephrine and dopamine transporters.
21147099 2011 Iron chelation down-regulates dopamine transporter expression by decreasing mRNA stability and increasing endocytosis in N2a cells.
21113497 2010 Effects of genetic variations in the dopaminergic system on fatigue in humans: gender aspects.
21112253 2011 Clinical and molecular characterisation of hereditary dopamine transporter deficiency syndrome: an observational cohort and experimental study.
21083670 2011 Limited associations of dopamine system genes with alcohol dependence and related traits in the Irish Affected Sib Pair Study of Alcohol Dependence (IASPSAD).
21078357 2011 Genetic influences of dopamine transport gene on alcohol dependence: a pooled analysis of 13 studies with 2483 cases and 1753 controls.
21050355 2011 Relationship between premature ejaculation and genetic polymorphisms of the dopamine transporter gene (SLC6A3).
21049181 2010 Association between the SLC6A3 A1343G polymorphism and schizophrenia.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20960275 2010 Does the dopamine transporter protein allele predict growth hormone testing results or response to growth hormone therapy?
20957668 2011 Effect of dopamine transporter genotype on caudate volume in childhood ADHD and controls.
20957647 2010 Fine-mapping reveals novel alternative splicing of the dopamine transporter.
20953736 2011 Relationship between striatal dopamine transporter availability and sleep quality in healthy adults.
20933528 2010 The role of DAT1 gene on the rapid detection of task novelty.
20862259 2010 Genetic determinants of time perception mediated by the serotonergic system.
20856247 2011 Modulation of orbitofrontal response to amphetamine by a functional variant of DAT1 and in vitro confirmation.
20845394 2011 Association between reward-related activation in the ventral striatum and trait reward sensitivity is moderated by dopamine transporter genotype.
20817043 2011 Dopamine transporter genotype predicts implicit sequence learning.
20800641 2011 Association between the dopamine transporter gene and the inattentive subtype of attention deficit hyperactivity disorder in Taiwan.
20739786 Abnormal expression of dopamine and serotonin transporters associated with the pathophysiologic mechanism of Tourette syndrome.
20736997 2010 DAT1 and COMT effects on delay discounting and trait impulsivity in male adolescents with attention deficit/hyperactivity disorder and healthy controls.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20732903 2010 Predicting sensation seeking from dopamine genes. A candidate-system approach.
20731709 2010 Association of DRD4 polymorphism with severity of oppositional defiant disorder, separation anxiety disorder and repetitive behaviors in children with autism spectrum disorder.
20700532 2010 Expression and function of variants of human catecholamine transporters lacking the fifth transmembrane region encoded by exon 6.
20688912 2010 Membrane cholesterol modulates the outward facing conformation of the dopamine transporter and alters cocaine binding.
20685009 2012 Association of serotonin and dopamine gene pathways with behavioral subphenotypes in dementia.
20678555 2010 Genetic markers of striatal dopamine predict individual differences in dysfunctional, but not functional impulsivity.
20672519 [Family based association study of DRD1, DRD2, DRD3, DRD4, DAT, COMT gene polymorphism in schizophrenia].
20661460 2010 Dopaminergic Control of Attentional Flexibility: Inhibition of Return is Associated with the Dopamine Transporter Gene (DAT1).
20644949 2011 Preserved serotonin transporter binding in de novo Parkinson's disease: negative correlation with the dopamine transporter.
20631685 2010 Dopamine transporter (SLC6A3) genotype impacts neurophysiological correlates of cognitive response control in an adult sample of patients with ADHD.
20631684 2011 Neurogenetics and pharmacology of learning, motivation, and cognition.
20620172 2011 Genetic variants within the dopaminergic system interact to modulate endocrine stress reactivity and recovery.
20603187 2010 Smoking, genes encoding dopamine pathway and risk for Parkinson's disease.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20593420 2011 Molecular imaging genetics of methylphenidate response in ADHD and substance use comorbidity.
20580759 2010 Pharacogenetic effects of dopamine transporter gene polymorphisms on response to chlorpromazine and clozapine and on extrapyramidal syndrome in schizophrenia.
20554017 2010 PTSD and dopaminergic genes, DRD2 and DAT, in multigenerational families exposed to the Spitak earthquake.
20551163 2010 The role of histamine degradation gene polymorphisms in moderating the effects of food additives on children's ADHD symptoms.
20548783 2010 Genomic features of the human dopamine transporter gene and its potential epigenetic States: implications for phenotypic diversity.
20505557 2010 Haplotypes of dopamine and serotonin transporter genes are associated with antisocial personality disorder in alcoholics.
20505554 2010 Association study between the DAT1, DBH and DRD2 genes and cocaine dependence in a Spanish sample.
20497233 2010 Neither single-marker nor haplotype analyses support an association between the dopamine transporter gene and heroin dependence in Han Chinese.
20493539 2010 Influence of genotype on dopamine transporter availability in human striatum and sleep architecture.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20464528 2010 Association analysis between 12 genetic variants of ten genes and personality traits in a young chinese Han population.
20463658 2010 Striatal dopamine mediates the interface between motivational and cognitive control in humans: evidence from genetic imaging.
20461808 2010 A case-control study of Parkinson's disease and tobacco use: gene-tobacco interactions.
20459035 2010 [Relationship between genetic polymorphisms of DAT1 VNTR and cancer with abnormal Hilit].
20450954 2010 Variants of the SLC6A3 (DAT1) polymorphism affect performance monitoring-related cortical evoked potentials that are associated with ADHD.
20430042 2010 Dopaminergic genotype influences spatial bias in healthy adults.
20427663 2010 Dysregulation of dopamine transporters via dopamine D2 autoreceptors triggers anomalous dopamine efflux associated with attention-deficit hyperactivity disorder.
20391341 2010 Association of C/T polymorphism in intron 14 of the dopamine transporter gene (rs40184) with major depression in a northeastern Thai population.
20367960 2010 [Association analysis between polymorphism of dopamine transporter variable number tandem repeat and breast cancer with abnormal Hilit].
20338240 2010 Reduced dopamine transporter density in the ventral striatum of patients with Parkinson's disease and pathological gambling.
20332413 2011 Lack of association between a 3'UTR VNTR polymorphism of dopamine transporter gene (SLC6A3) and ADHD in a Brazilian sample of adult patients.
20218802 2010 Interaction between serotonin 5-HT2A receptor gene and dopamine transporter (DAT1) gene polymorphisms influences personality trait of persistence in Austrian Caucasians.
20210499 2010 Polymorphisms in dopamine system genes are associated with individual differences in attention in infancy.
20205808 2010 Association between dopaminergic polymorphisms and borderline personality traits among at-risk young adults and psychiatric inpatients.
20179766 2010 The dopamine transporter gene, a spectrum of most common risky behaviors, and the legal status of the behaviors.
20170711 2010 Association analysis between polymorphisms in the dopamine D2 receptor (DRD2) and dopamine transporter (DAT1) genes with cocaine dependence.
20161733 2010 Insertion of tetracysteine motifs into dopamine transporter extracellular domains.
20146095 2010 Personality mediation of genetic effects on Attention-Deficit/Hyperactivity Disorder.
20141587 2010 The dopamine transporter gene (DAT1) polymorphism is associated with premature ejaculation.
20141527 2010 The role of the dopamine transporter DAT1 genotype on the neural correlates of cognitive flexibility.
20132487 2010 Function of dopamine transporter is compromised in DYT1 transgenic animal model in vivo.
20117122 2010 Dopamine transporter regulates the enhancement of novelty processing by a negative emotional context.
20098830 2009 Association between a SLC6A3 intron 8 VNTR functional polymorphism and ADHD in a Brazilian sample of adult patients.
20091113 2010 Polymorphisms in dopamine transporter (SLC6A3) are associated with stimulant effects of D-amphetamine: an exploratory pharmacogenetic study using healthy volunteers.
20086298 2009 Lack of association between the -839C/T polymorphism in the SLC6A3 gene promoter and schizophrenia in the Iranian population.
20074437 Candidate-gene approach in fibromyalgia syndrome: association analysis of the genes encoding substance P receptor, dopamine transporter and alpha1-antitrypsin.
20053379 2010 Neural response to working memory load varies by dopamine transporter genotype in children.
20051513 2010 Lysine 63-linked polyubiquitination of the dopamine transporter requires WW3 and WW4 domains of Nedd4-2 and UBE2D ubiquitin-conjugating enzymes.
20049490 2010 Response to methylphenidate is not influenced by DAT1 polymorphisms in a sample of Brazilian adult patients with ADHD.
20041956 2010 Lack of association between schizophrenia and polymorphisms in dopamine metabolism and transport genes.
20033274 2010 Catechol-o-methyltransferase genotype and childhood trauma may interact to impact schizotypal personality traits.
20026227 2010 Dopamine transporter gene variation modulates activation of striatum in youth with ADHD.
20021740 2010 Study of the prevalence of Parkinson's disease using dopamine transporter imaging.
20006992 2010 Correlation of a set of gene variants, life events and personality features on adult ADHD severity.
19960520 2009 The role of the dopamine transporter (DAT) in the development of PTSD in preschool children.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19944766 2010 A pilot multivariate parallel ICA study to investigate differential linkage between neural networks and genetic profiles in schizophrenia.
19906444 2009 Effect of candidate gene polymorphisms on the course of attention deficit hyperactivity disorder.
19892410 2010 Lack of association between antipsychotic-induced extrapyramidal symptoms and polymorphisms in dopamine metabolism and transport genes.
19890261 2010 Multicenter analysis of the SLC6A3/DAT1 VNTR haplotype in persistent ADHD suggests differential involvement of the gene in childhood and persistent ADHD.
19884604 2009 Altered effect of dopamine transporter 3'UTR VNTR genotype on prefrontal and striatal function in schizophrenia.
19879111 2010 Association of promoter variants of human dopamine transporter gene with schizophrenia in Han Chinese.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19858760 2009 A candidate gene analysis of methylphenidate response in attention-deficit/hyperactivity disorder.
19844206 2009 Sequence variations of ABCB1, SLC6A2, SLC6A3, SLC6A4, CREB1, CRHR1 and NTRK2: association with major depression and antidepressant response in Mexican-Americans.
19827313 2009 [Association between nicotine dependence and the -521 promoter polymorfism of the dopamine D4 receptor in patients with major depression].
19819301 2009 Working memory plasticity modulated by dopamine transporter genotype.
19818050 2010 Affect-modulated startle reflex and dopamine D4 receptor gene variation.
19805704 2009 Dopaminergic haplotype as a predictor of spatial inattention in children with attention-deficit/hyperactivity disorder.
19796878 2009 Associations between polymorphisms in dopamine neurotransmitter pathway genes and pain response in healthy humans.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19779799 2009 Dopamine transporter (DAT1) VNTR polymorphism in 12 Indian populations.
19772578 2009 Two-stage case-control association study of dopamine-related genes and migraine.
19769301 2009 [Role of dopamine transporter gene (DAT1) polymorphisms in personality traits variation].
19767592 2010 Is the inattentive subtype of ADHD different from the combined/hyperactive subtype?
19766189 2009 Dopamine transporter glycosylation correlates with the vulnerability of midbrain dopaminergic cells in Parkinson's disease.
19766158 2010 Genetic polymorphisms in the dopamine-2 receptor (DRD2), dopamine-3 receptor (DRD3), and dopamine transporter (SLC6A3) genes in schizophrenia: Data from an association study.
19764934 2009 The interaction of reward genes with environmental factors in contribution to alcoholism in mexican americans.
19764480 2009 [Influence of serotonin (5-HT) 2A-receptor and transporter (5HTT) gene polymorphism upon the effect of olanzapine].
19761593 2009 Influences of polymorphic variants of DRD2 and SLC6A3 genes, and their combinations on smoking in Polish population.
19740369 2009 The interaction between the dopamine transporter gene and age at onset in relation to tobacco and alcohol use among 19-year-olds.
19739106 2010 The association of the dopamine transporter gene and the dopamine receptor 2 gene with delirium, a meta-analysis.
19728374 2010 Epigenetic dysregulation of dopaminergic genes in eating disorders.
19726478 2009 A neurochemical approach to valuation sensitivity over gains and losses.
19717274 2010 Genetic, personality, and environmental predictors of drug use in adolescents.
19693267 2009 Financial and psychological risk attitudes associated with two single nucleotide polymorphisms in the nicotine receptor (CHRNA4) gene.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19676101 2010 Effect of dopamine transporter gene (SLC6A3) variation on dorsal anterior cingulate function in attention-deficit/hyperactivity disorder.
19673036 2009 Association of tagging single nucleotide polymorphisms on 8 candidate genes in dopaminergic pathway with schizophrenia in Croatian population.
19666577 2009 Epistasis between the DAT 3' UTR VNTR and the COMT Val158Met SNP on cortical function in healthy subjects and patients with schizophrenia.
19664686 2009 Potential association of DRD2 and DAT1 genetic variation with heroin dependence.
19655343 2009 Dopamine transporter gene polymorphism moderates the effects of severe deprivation on ADHD symptoms: developmental continuities in gene-environment interplay.
19647327 2009 No association between lithium full responders and the DRD1, DRD2, DRD3, DAT1, 5-HTTLPR and HTR2A genes in a Sardinian sample.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19621370 2010 Variation in TREK1 gene linked to depression-resistant phenotype is associated with potentiated neural responses to rewards in humans.
19590691 2009 Dopamine transporter genetic variants and pesticides in Parkinson's disease.
19590515 2009 Association between dopaminergic genes (SLC6A3 and DRD2) and stuttering among Han Chinese.
19576958 2009 Replication of an association of a promoter polymorphism of the dopamine transporter gene and Attention Deficit Hyperactivity Disorder.
19519258 2009 Dopamine transporter genotype and stimulant side effect factors in youth diagnosed with attention-deficit/hyperactivity disorder.
19513381 2008 Genetic markers of predisposition to increased anxiety.
19506906 2009 Candidate gene studies of ADHD: a meta-analytic review.
19506579 2009 A common variant in DRD3 gene is associated with risperidone-induced extrapyramidal symptoms.
19494806 2009 Dopamine genes and nicotine dependence in treatment-seeking and community smokers.
19490304 2009 Dopamine and serotonin transporter genotypes moderate sensitivity to maternal expressed emotion: the case of conduct and emotional problems in attention deficit/hyperactivity disorder.
19482231 2009 Influence of SLC6A3 and COMT variation on neural activation during response inhibition.
19478460 2009 Homozygous loss-of-function mutations in the gene encoding the dopamine transporter are associated with infantile parkinsonism-dystonia.
19450132 2009 Polymorphisms in the dopamine transporter gene (SLC6A3/DAT1) and alcohol dependence in humans: a systematic review.
19447357 2009 Epistatic interaction between COMT and DAT1 genes on eating behavior: a pilot study.
19443134 2009 An interaction between DAT1 and having an alcoholic father predicts serious alcohol problems in a sample of males.
19418498 2010 Familiality and molecular genetics of attention networks in ADHD.
19409950 2009 Verbal but not performance IQ is highly correlated to externalizing behavior in boys with ADHD carrying both DRD4 and DAT1 risk genotypes.
19390575 2009 Lung cancer susceptibility model based on age, family history and genetic variants.
19388000 2010 ADHD and DAT1: further evidence of paternal over-transmission of risk alleles and haplotype.
19376159 2009 The -67 A/T promoter polymorphism in the dopamine transporter gene affects personality traits of Japanese healthy females.
19368898 2009 Relationships between angry-impulsive personality traits and genetic polymorphisms of the dopamine transporter.
19364291 2009 Dopamine-related genotypes and the dose-response effect of methylphenidate on eating in attention-deficit/hyperactivity disorder youths.
19360691 2008 Examination of association to autism of common genetic variationin genes related to dopamine.
19352220 2009 Association between harmful alcohol consumption behavior and dopamine transporter (DAT1) gene polymorphisms in a male Finnish population.
19352218 2009 Candidate gene analysis in an on-going genome-wide association study of attention-deficit hyperactivity disorder: suggestive association signals in ADRA1A.
19309018 2010 Genetic polymorphisms in the DRD2, DRD3, and SLC6A3 gene in elderly patients with delirium.
19304505 2009 [Single nucleotide polymorphisms of DAT and DRD(2) genes in Han Chinese population and their association with stuttering].
19288168 2009 Effects of maternal and paternal smoking on attentional control in children with and without ADHD.
19247849 2010 Low novelty seeking and high self directedness scores in alcohol-dependent patients without comorbid psychiatric disorders homozygous for the A10 allele of the dopamine transporter gene.
19196467 2009 Association study of promoter polymorphisms at the dopamine transporter gene in Attention Deficit Hyperactivity Disorder.
19193883 2009 Negative regulation of dopamine transporter endocytosis by membrane-proximal N-terminal residues.
19183461 2009 SLC6A3 and body mass index in the Prostate, Lung, Colorectal and Ovarian Cancer Screening Trial.
19176830 2009 Genetically determined interaction between the dopamine transporter and the D2 receptor on prefronto-striatal activity and volume in humans.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19152006 2009 New genetic evidence for involvement of the dopamine system in migraine with aura.
19146920 2009 Genetic interaction analysis for DRD4 and DAT1 genes in a group of Mexican ADHD patients.
19142409 2008 Molecular genetic case-control women investigation from the first Brazilian high-risk study on functional psychosis.
19120712 2008 Association of ADHD, tics, and anxiety with dopamine transporter (DAT1) genotype in autism spectrum disorder.
19104049 2009 Variation in dopamine genes influences responsivity of the human reward system.
19098122 2009 A juxtamembrane mutation in the N terminus of the dopamine transporter induces preference for an inward-facing conformation.
19091889 2009 Striatal dopamine transporter availability associated with polymorphisms in the dopamine transporter gene SLC6A3.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19025233 2008 Relations between multi-informant assessments of ADHD symptoms, DAT1, and DRD4.
18973248 2009 Serotonin and dopamine transporter genes do not influence depression in Parkinson's disease.
18937842 2008 The influence of serotonin- and other genes on impulsive behavioral aggression and cognitive impulsivity in children with attention-deficit/hyperactivity disorder (ADHD): Findings from a family-based association test (FBAT) analysis.
18937294 2008 Genome-wide association scan of the time to onset of attention deficit hyperactivity disorder.
18841010 2008 Investigation of the role of the dopamine transporter in susceptibility to behavioural and psychological symptoms of patients with probable Alzheimer's disease.
18831910 Polymorphisms in genes encoding the serotonin and dopamine pathways in two sisters with metachromatic leukodystrophy.
18826446 2008 Personality endophenotypes for bipolar affective disorder: a family-based genetic association analysis.
18821566 2008 SNPs in dopamine D2 receptor gene (DRD2) and norepinephrine transporter gene (NET) are associated with continuous performance task (CPT) phenotypes in ADHD children and their families.
18810510 2009 Association of dopamine transporter and monoamine oxidase molecular polymorphisms with sudden infant death syndrome and stillbirth: new insights into the serotonin hypothesis.
18802924 2008 Association of the dopamine transporter (SLC6A3/DAT1) gene 9-6 haplotype with adult ADHD.
18802919 2008 A common haplotype at the dopamine transporter gene 5' region is associated with attention-deficit/hyperactivity disorder.
18788325 2008 Delinquent peer group formation: evidence of a gene x environment correlation.
18779819 2010 Association of maternal dopamine transporter genotype with negative parenting: evidence for gene x environment interaction with child disruptive behavior.
18769827 2008 [Combination of DRD4 and DAT1 genotypes is an important risk factor for attention deficit disorder with hyperactivity families living in Santiago, Chile].
18762727 2008 Lack of association between the dopamine transporter gene 3' VNTR polymorphism and attention deficit hyperactivity disorder in Chinese Han children: case-control and family-based studies.
18729135 2008 A review and analysis of the relationship between neuropsychological measures and DAT1 in ADHD.
18720903 2008 DAT1 VNTR polymorphisms in a European and an African population: identification of a new allele.
18704100 2009 DAT genotype modulates brain and behavioral responses elicited by cigarette cues.
18690118 2008 Dopamine and opioid gene variants are associated with increased smoking reward and reinforcement owing to negative mood.
18690117 2008 Gene and gene by sex associations with initial sensitivity to nicotine in nonsmokers.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18668530 2008 Association of ADHD with genetic variants in the 5'-region of the dopamine transporter gene: evidence for allelic heterogeneity.
18665883 2008 Cognitive functioning in affected sibling pairs with ADHD: familial clustering and dopamine genes.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18588943 2008 Midbrain serotonin and striatum dopamine transporter binding in double depression: a one-year follow-up study.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18580852 2008 Clinical and molecular-genetic markers of ADHD in children.
18563707 2008 Pharmacogenetics of methylphenidate response in attention deficit/hyperactivity disorder: association with the dopamine transporter gene (SLC6A3).
18563706 2009 The impact of genetic variation in DRD2 and SLC6A3 on smoking cessation in a cohort of participants 1 year after enrollment in a lung cancer screening study.
18559107 2008 Dopamine transporter 3'UTR VNTR genotype is a marker of performance on executive function tasks in children with ADHD.
18553640 2008 Genetic heterogeneity in ADHD: DAT1 gene only affects probands without CD.
18553389 2009 Dopamine transporter polymorphism modulates oculomotor function and DAT1 mRNA expression in schizophrenia.
18552399 Association between the Stin2 VNTR polymorphism of the serotonin transporter gene and treatment outcome in alcohol-dependent patients.
18504048 2009 Promoter specific methylation of the dopamine transporter gene is altered in alcohol dependence and associated with craving.
18468730 2008 Truncation of human dopamine transporter by protease calpain.
18446263 2008 Transmission disequilibrium studies in early onset of obsessive-compulsive disorder for polymorphisms in genes of the dopaminergic system.
18444252 2008 Neurotransmission and bipolar disorder: a systematic family-based association study.
18434921 2008 Genetic variation in dopamine pathways differentially associated with smoking progression in adolescence.
18434601 2008 Genetic complementation screen identifies a mitogen-activated protein kinase phosphatase, MKP3, as a regulator of dopamine transporter trafficking.
18426798 2008 An intracellular interaction network regulates conformational transitions in the dopamine transporter.
18404133 2008 Some ADHD polymorphisms (in genes DAT1, DRD2, DRD3, DBH, 5-HTT) in case-control study of 100 subjects 6-10 age.
18393256 2008 [Responsive changes to MPTP in rats with DAT inhibited by antisense oligonucleotides].
18374902 2008 Epistasis between dopamine regulating genes identifies a nonlinear response of the human hippocampus during memory tasks.
18366104 Preliminary evidence that specific candidate genes are associated with adolescent-onset antisocial behavior.
18361424 2008 Family based association study of pediatric bipolar disorder and the dopamine transporter gene (SLC6A3).
18331164 2008 Visual search performance in children rated as good or poor attenders: the differential impact of DAT1 genotype, IQ, and chronological age.
18327668 2008 Polymorphism in environment responsive genes and association with Parkinson disease.
18270970 2008 Worldwide genetic variation in dopamine and serotonin pathway genes: implications for association studies.
18239643 2008 Genes implicated in serotonergic and dopaminergic functioning predict BMI categories.
18216182 2008 Labeling of dopamine transporter transmembrane domain 1 with the tropane ligand N-[4-(4-azido-3-[125I]iodophenyl)butyl]-2beta-carbomethoxy-3beta-(4-chlorophenyl)tropane implicates proximity of cocaine and substrate active sites.
18214865 2008 Catechol-O-methyltransferase Val158Met polymorphism is associated with methylphenidate response in ADHD children.
18214864 2008 Lack of association of the dopamine transporter gene in a French ADHD sample.
18206700 2008 Interaction of dopamine transporter genotype with prenatal smoke exposure on ADHD symptoms.
18197081 2008 Case-control and within-family tests for an association between conduct disorder and DAT1.
18197080 2008 Effect of genetic polymorphisms on smoking cessation: a trial of bupropion in Korean male smokers.
18188752 2008 Interactions between genotype and retrospective ADHD symptoms predict lifetime smoking risk in a sample of young adults.
18181793 2008 Association between polymorphisms in the dopamine transporter gene and depression: evidence for a gene-environment interaction in a sample of juvenile detainees.
18174826 2008 Dopamine transporter genotype conveys familial risk of attention-deficit/hyperactivity disorder through striatal activation.
18165969 2008 Association of the dopamine transporter gene and ADHD symptoms in a Canadian population-based sample of same-age twins.
18094849 2007 Association analysis between a VNTR intron 8 polymorphism of the dopamine transporter gene (SLC6A3) and obsessive- compulsive disorder in a Brazilian sample.
18088380 2008 Substrates dissociate dopamine transporter oligomers.
18081165 2008 Genetic analyses of dopamine related genes in adult ADHD patients suggest an association with the DRD5-microsatellite repeat, but not with DRD4 or SLC6A3 VNTRs.
18070248 2008 The 3' part of the dopamine transporter gene DAT1/SLC6A3 is associated with withdrawal seizures in patients with alcohol dependence.
18053732 2008 The synthesis of bivalent 2beta-carbomethoxy-3beta-(3,4-dichlorophenyl)-8-heterobicyclo[3.2.1]octanes as probes for proximal binding sites on the dopamine and serotonin transporters.
18046306 2008 Spatial attentional bias as a marker of genetic risk, symptom severity, and stimulant response in ADHD.
18045777 2008 A network of dopaminergic gene variations implicated as risk factors for schizophrenia.
18023044 2008 Intelligence in DSM-IV combined type attention-deficit/hyperactivity disorder is not predicted by either dopamine receptor/transporter genes or other previously identified risk alleles for attention-deficit/hyperactivity disorder.
18004640 2008 Nigrostriatal involvement in ataxia with oculomotor apraxia type 1.
17979508 2007 Dopamine transporter polymorphisms and risperidone response in Chinese schizophrenia patients: an association study.
17965994 2009 Dopamine transporter genotype influences N-acetyl-aspartate in the left putamen.
17955458 2007 Gene-environment interactions in the development of combined type ADHD: evidence for a synapse-based model.
17955457 2008 Response to methylphenidate in adults with ADHD is associated with a polymorphism in SLC6A3 (DAT1).
17948872 2008 Association of dopamine, serotonin, and nicotinic gene polymorphisms with methylphenidate response in ADHD.
17934207 2008 Sequence variation in the primate dopamine transporter gene and its relationship to social dominance.
17928119 2008 Genetics of Lesch's typology of alcoholism.
17907820 2007 Food reinforcement, the dopamine D2 receptor genotype, and energy intake in obese and nonobese humans.
17893706 2009 Genetic variation in components of dopamine neurotransmission impacts ventral striatal reactivity associated with impulsivity.
17873367 2007 Parkin disrupts the alpha-synuclein/dopamine transporter interaction: consequences toward dopamine-induced toxicity.
17711354 2007 Membrane mobility and microdomain association of the dopamine transporter studied with fluorescence correlation spectroscopy and fluorescence recovery after photobleaching.
17705902 2007 Genotype and neuropsychological response inhibition as resilience promoters for attention-deficit/hyperactivity disorder, oppositional defiant disorder, and conduct disorder under conditions of psychosocial adversity.
17704152 2007 How dopamine transporter interacts with dopamine: insights from molecular modeling and simulation.
17692827 2007 Cytotoxicity of beta-carbolines in dopamine transporter expressing cells: structure-activity relationships.
17690944 2008 Family-based association analysis of functional VNTR polymorphisms in the dopamine transporter gene in migraine with and without aura.
17689985 2007 Impact of the COMT Val108/158 Met and DAT genotypes on prefrontal function in healthy subjects.
17679637 2007 Polymorphisms of the dopamine D4 receptor, clinical outcome, and cortical structure in attention-deficit/hyperactivity disorder.
17671965 2007 Polymorphisms TaqI A of the DRD2, BalI of the DRD3, exon III repeat of the DRD4, and 3' UTR VNTR of the DAT: association with childhood ADHD in male African-Caribbean cocaine dependents?
17654295 2007 Pharmacogenetic clinical trial of sustained-release bupropion for smoking cessation.
17633563 2007 [Population study of the Udmurt population: analysis of ten polymorphic DNA loci of the nuclear genome].
17621383 2008 The effects of the dopamine and serotonin transporter polymorphisms on clinical features and treatment response in geriatric depression: a pilot study.
17608284 2007 [Dopaminergic polymorphisms and regulatory problems in infancy].
17582621 2008 No association between the DAT1 10-repeat allele and ADHD in the Iranian population.
17579611 2007 Association and linkage of allelic variants of the dopamine transporter gene in ADHD.
17579368 2008 Testing for gene x environment interaction effects in attention deficit hyperactivity disorder and associated antisocial behavior.
17579365 2007 Relationship between VNTR polymorphisms of the human dopamine transporter gene and expression in post-mortem midbrain tissue.
17549062 2007 Dopaminergic genotype biases spatial attention in healthy children.
17539957 2007 Association study of a functional variant in intron 8 of the dopamine transporter gene and migraine susceptibility.
17526637 D2 dopamine receptor gene haplotypes and their influence on alcohol and tobacco consumption magnitude in alcohol-dependent individuals.
17525955 2008 Analysis of DRD4 and DAT polymorphisms and behavioral inhibition in healthy adults: implications for impulsivity.
17508996 2007 Association between dopamine transporter genotypes and smoking cessation: a meta-analysis.
17508355 2007 Dopaminergic candidate genes in Tourette syndrome: association between tic severity and 3' UTR polymorphism of the dopamine transporter gene.
17501935 2007 Evidence for an association of the dopamine D5 receptor gene on age at onset of attention deficit hyperactivity disorder.
17500623 2007 Joint effect of dopaminergic genes on likelihood of smoking following treatment with bupropion SR.
17485610 2007 Interacting effects of the dopamine transporter gene and psychosocial adversity on attention-deficit/hyperactivity disorder symptoms among 15-year-olds from a high-risk community sample.
17483451 2007 Gene-gene interaction associated with neural reward sensitivity.
17466074 2007 Genetic polymorphisms in dopamine-related genes and smoking cessation in women: a prospective cohort study.
17449559 2007 Gene-environment interactions in parkinsonism and Parkinson's disease: the Geoparkinson study.
17449448 2007 Association in alcoholic patients between psychopathic traits and the additive effect of allelic forms of the CNR1 and FAAH endocannabinoid genes, and the 3' region of the DRD2 gene.
17440978 2007 A meta-analysis of association studies between the 10-repeat allele of a VNTR polymorphism in the 3'-UTR of dopamine transporter gene and attention deficit hyperactivity disorder.
17440951 2007 Gene-lifecourse interaction for alcohol consumption in adolescence and young adulthood: five monoamine genes.
17440935 2007 DAT1 3'-UTR 9R allele: preferential transmission in Indian children with attention deficit hyperactivity disorder.
17439486 2007 Valproate robustly increases Sp transcription factor-mediated expression of the dopamine transporter gene within dopamine cells.
17432702 2007 Sex and genetic associations with cerebrospinal fluid dopamine and metabolite production after severe traumatic brain injury.
17427194 2007 Investigation of parent-of-origin effects in ADHD candidate genes.
17427187 2007 Why do young women smoke? IV. Role of genetic variation in the dopamine transporter and lifetime traumatic experience.
17413453 2007 No association between a common haplotype of the 6 and 10-repeat alleles in intron 8 and the 3'UTR of the DAT1 gene and adult attention deficit hyperactivity disorder.
17403983 2007 Confirmation that a specific haplotype of the dopamine transporter gene is associated with combined-type ADHD.
17392738 2007 Interaction between BDNF Val66Met and dopamine transporter gene variation influences anxiety-related traits.
17380124 2007 Dopamine transporter cell surface localization facilitated by a direct interaction with the dopamine D2 receptor.
17325714 2007 No preferential transmission of paternal alleles at risk genes in attention-deficit hyperactivity disorder.
17316573 2007 Gender dimorphism in the DAT1 -67 T-allele homozygosity and predisposition to bipolar disorder.
17314918 2007 Dopamine transporter gene (DAT1) associated with appetite suppression to methylphenidate in a case-control study of binge eating disorder.
17267664 2007 D2 receptors regulate dopamine transporter function via an extracellular signal-regulated kinases 1 and 2-dependent and phosphoinositide 3 kinase-independent mechanism.
17264803 2007 Dopamine transporter polymorphisms are associated with short-term response to smoking cessation treatment.
17260170 2007 Dopamine transporter immunoreactivity in peripheral blood lymphocytes discriminates Parkinson's disease from essential tremor.
17255098 2007 Localization of cocaine analog [125I]RTI 82 irreversible binding to transmembrane domain 6 of the dopamine transporter.
17250655 2007 Substrates and inhibitors display different sensitivity to expression level of the dopamine transporter in heterologously expressing cells.
17245411 2007 Dopamine transporter, gender, and number of sexual partners among young adults.
17225991 2007 Antipsychotic-induced extrapyramidal symptoms in patients with schizophrenia: associations with dopamine and serotonin receptor and transporter polymorphisms.
17192955 2007 Association of dopamine transporter genotype with disruptive behavior disorders in an eight-year longitudinal study of children and adolescents.
17191306 2006 Lack of association between polymorphisms of the dopamine receptor D4 and dopamine transporter genes and personality traits in a Korean population.
17187291 2007 Growth hormone response in low-dose apomorphine test correlates with nigrostriatal dopamine transporter binding in patients with Parkinson's disease.
17175058 2007 Polymorphisms of dopamine receptor/transporter genes and risk of non-small cell lung cancer.
17171650 2007 Dopaminergic polymorphisms in Tourette syndrome: association with the DAT gene (SLC6A3).
17157268 2007 Prenatal smoking exposure and dopaminergic genotypes interact to cause a severe ADHD subtype.
17150335 2007 Dopamine transporter (DAT) genotype (VNTR) and phenotype in extrapyramidal symptoms induced by antipsychotics.
17135598 2006 No evidence for a major role of polymorphisms during bupropion treatment.
17130883 2006 No association between dopaminergic polymorphisms and intelligence variability in attention-deficit/hyperactivity disorder.
17120049 2007 Contributions of the DAT1 and DRD2 genes to serious and violent delinquency among adolescents and young adults.
17109713 2006 Schizotypy, attention deficit hyperactivity disorder, and dopamine genes.
17079728 2007 Three ubiquitin conjugation sites in the amino terminus of the dopamine transporter mediate protein kinase C-dependent endocytosis of the transporter.
17063150 2007 Dopamine transporter 3'-UTR VNTR genotype and ADHD: a pharmaco-behavioural genetic study with methylphenidate.
17044101 2007 A promoter polymorphism (-839 C > T) at the dopamine transporter gene is associated with attention deficit/hyperactivity disorder in Brazilian children.
17044099 2007 Evaluation of potential gene-gene interactions for attention deficit hyperactivity disorder in the Han Chinese population.
17042887 2006 Association study of 5'-UTR polymorphisms of the human dopamine transporter gene with manic depression.
17028370 2006 Attention deficit hyperactivity disorder.
17023870 2006 Pharmacogenetics of methylphenidate response in preschoolers with ADHD.
16963468 2006 5' and 3' region variability in the dopamine transporter gene (SLC6A3), pesticide exposure and Parkinson's disease risk: a hypothesis-generating study.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16930369 2006 A genetic association study of dopamine metabolism-related genes and chronic headache with drug abuse.
16917950 2006 Absence of association with DAT1 polymorphism and response to methylphenidate in a sample of adults with ADHD.
16894395 2006 The analysis of 51 genes in DSM-IV combined type attention deficit hyperactivity disorder: association signals in DRD4, DAT1 and 16 other genes.
16818870 2006 Gene variants of brain dopamine pathways and smoking-induced dopamine release in the ventral caudate/nucleus accumbens.
16783497 2006 Family-based study of markers at the 5'-flanking region of the human dopamine transporter gene reveals potential association with schizophrenic psychoses.
16782077 2006 Attention-deficit/hyperactivity disorder (ADHD) association with the DAT1 core promoter -67 T allele.
16760197 2006 Dopamine transporter genotype influences the physiological response to medication in ADHD.
16741944 2006 An examination of the behavioral and neuropsychological correlates of three ADHD candidate gene polymorphisms (DRD4 7+, DBH TaqI A2, and DAT1 40 bp VNTR) in hyperactive and normal children followed to adulthood.
16712949 2006 Performance on the Wisconsin Card Sorting Test in schizophrenia and genes of dopaminergic inactivation (COMT, DAT, NET).
16710758 Common human 5' dopamine transporter (SLC6A3) haplotypes yield varying expression levels in vivo.
16702979 2007 A 40-basepair VNTR polymorphism in the dopamine transporter (DAT1) gene and the rapid response to antidepressant treatment.
16674552 2006 Obesity is associated with genetic variants that alter dopamine availability.
16671078 2006 Striatal dopamine transporter binding in Parkinson's disease associated with the LRRK2 Gly2019Ser mutation.
16623961 2006 A dopamine transporter polymorphism is a risk factor for borderline personality disorder in depressed patients.
16611807 2006 Additive effects of genetic variation in dopamine regulating genes on working memory cortical activity in human brain.
16604301 2006 An interaction between the serotonin transporter promoter region and dopamine transporter polymorphisms contributes to harm avoidance and reward dependence traits in normal healthy subjects.
16585476 2006 Prediction of heterogeneity in intelligence and adult prognosis by genetic polymorphisms in the dopamine system among children with attention-deficit/hyperactivity disorder: evidence from 2 birth cohorts.
16569110 2006 An association between the DAT1 polymorphism and smoking behavior in young adults from the National Longitudinal Study of Adolescent Health.
16545000 2006 The VNTR polymorphism in the human dopamine transporter gene: improved detection and absence of association of VNTR alleles with attention-deficit hyperactivity disorder.
16537431 2006 A dopamine transporter gene functional variant associated with cocaine abuse in a Brazilian sample.
16526040 2006 The effect of dopamine D2, D5 receptor and transporter (SLC6A3) polymorphisms on the cue-elicited heroin craving in Chinese.
16526026 2006 Association of the DAT1 polymorphism with attention deficit hyperactivity disorder (ADHD): a family-based approach.
16424823 2006 Genetic susceptibility to tardive dyskinesia among schizophrenia subjects: IV. Role of dopaminergic pathway gene polymorphisms.
16406146 2006 Dopamine transporter-mediated cytotoxicity of 6-hydroxydopamine in vitro depends on expression of mutant alpha-synucleins related to Parkinson's disease.
16402340 2006 No association between VNTR polymorphisms of dopamine transporter gene and attention deficit hyperactivity disorder in Chinese children.
16389711 [Meta-analysis of candidate genes in attention-deficit hyperactivity disorder].
16389200 2006 A common haplotype of the dopamine transporter gene associated with attention-deficit/hyperactivity disorder and interacting with maternal use of alcohol during pregnancy.
16368111 2006 The dopamine transporter gene and the impulsivity phenotype in attention deficit hyperactivity disorder: a case-control association study in a Korean sample.
16342279 2006 Genotypic interaction between DRD4 and DAT1 loci is a high risk factor for attention-deficit/hyperactivity disorder in Chilean families.
16309561 2005 The variable number of tandem repeats element in DAT1 regulates in vitro dopamine transporter density.
16261167 2006 Identification of additional variants within the human dopamine transporter gene provides further evidence for an association with bipolar disorder in two independent samples.
16222334 2006 A genome-wide scan for attention-deficit/hyperactivity disorder in 155 German sib-pairs.
16216085 2005 Disruption of the interaction of alpha-synuclein with microtubules enhances cell surface recruitment of the dopamine transporter.
16201143 2005 DAT1 VNTR allele frequencies in the Omani population.
16178931 2005 High sibling correlation on methylphenidate response but no association with DAT1-10R homozygosity in Dutch sibpairs with ADHD.
16178930 2005 Collaborative analysis of DRD4 and DAT genotypes in population-defined ADHD subtypes.
16171832 2005 Sequence variation in the human dopamine transporter gene in children with attention deficit hyperactivity disorder.
16168728 2005 Dissecting the attention deficit hyperactivity disorder (ADHD) phenotype: sustained attention, response variability and spatial attentional asymmetries in relation to dopamine transporter (DAT1) genotype.
16165273 2005 Family-based association study of DAT1 and DRD4 polymorphism in Korean children with ADHD.
16139170 2005 SERT and DAT availabilities under citalopram treatment in obsessive-compulsive disorder (OCD).
16125912 2006 Genetic polymorphisms of alcohol and aldehyde dehydrogenase, dopamine and serotonin transporters in familial and non-familial alcoholism.
16123773 2005 Association between dopamine transporter (DAT1) genotype, left-sided inattention, and an enhanced response to methylphenidate in attention-deficit hyperactivity disorder.
16110277 2005 Cocaine abuse elevates alpha-synuclein and dopamine transporter levels in the human striatum.
16109712 2005 Enhanced ubiquitylation and accelerated degradation of the dopamine transporter mediated by protein kinase C.
16109590 2005 Allelic association of a dopamine transporter gene polymorphism with antisocial behaviour in heroin-dependent patients.
16103889 2005 A dopamine transporter mutation associated with bipolar affective disorder causes inhibition of transporter cell surface expression.
16082693 2005 Sequence variation in the 3'-untranslated region of the dopamine transporter gene and attention-deficit hyperactivity disorder (ADHD).
16082688 2005 No support for association between the dopamine transporter (DAT1) gene and ADHD.
16041244 2005 Dopamine transporter (SLC6A3) 5' region haplotypes significantly affect transcriptional activity in vitro but are not associated with Parkinson's disease.
16024787 2005 IRIP, a new ischemia/reperfusion-inducible protein that participates in the regulation of transporter activity.
15996968 Association of the dopamine transporter gene with alcoholism.
15993876 2005 Association of the risk allele of dopamine transporter gene (DAT1*10) in Omani male children with attention-deficit hyperactivity disorder.
15940306 2005 Dopamine transporter haplotype and attention-deficit hyperactivity disorder.
15924135 2005 Nonclassical, distinct endocytic signals dictate constitutive and PKC-regulated neurotransmitter transporter internalization.
15872345 2005 Increased dopamine transporter availability associated with the 9-repeat allele of the SLC6A3 gene.
15845322 2005 Genetic influences on quantity of alcohol consumed by adolescents and young adults.
15827573 2005 Dopamine transporter genotype and methylphenidate dose response in children with ADHD.
15823165 2005 Antipsychotics and dopamine transporter gene polymorphisms in delirium patients.
15809660 2005 Association of the dopamine transporter (DAT1) 10/10-repeat genotype with ADHD symptoms and response inhibition in a general population sample.
15768394 2005 Association analysis of the dopamine transporter (DAT1)-67A/T polymorphism in bipolar disorder.
15763138 2005 Dopamine and norepinephrine transporter-dependent c-Fos production in vitro: relevance to neuroadaptation.
15724142 2005 Differential effects of DRD4 and DAT1 genotype on fronto-striatal gray matter volumes in a sample of subjects with attention deficit hyperactivity disorder, their unaffected siblings, and controls.
15722958 2005 Meta-analysis of family-based association studies between the dopamine transporter gene and attention deficit hyperactivity disorder.
15708296 2005 The role of the striatal dopamine transporter in cognitive aging.
15683546 2005 Transient expression analysis of allelic variants of a VNTR in the dopamine transporter gene (DAT1).
15608954 2004 Lack of association between VNTR polymorphism of dopamine transporter gene (SLC6A3) and schizophrenia in a Brazilian sample.
15605097 2004 [Association studies of G352A polymorphism of dopamine transporter gene in Han Chinese attention deficit hyperactivity disorder patients].
15602501 2005 Dopamine transporter gene associated with diminished subjective response to amphetamine.
15567077 2005 Meta-analysis shows schizophrenia is not associated with the 40-base-pair repeat polymorphism of the dopamine transporter gene.
15542698 2004 Association studies of neurotransmitter gene polymorphisms in alcoholic Caucasians.
15505207 2004 Effect of torsinA on membrane proteins reveals a loss of function and a dominant-negative phenotype of the dystonia-associated DeltaE-torsinA mutant.
15492001 2004 Parkin increases dopamine uptake by enhancing the cell surface expression of dopamine transporter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381926 2005 Effects of dopamine D2 receptor (DRD2) and transporter (SLC6A3) polymorphisms on smoking cue-induced cigarette craving among African-American smokers.
15380858 2004 Association study of dopamine transporter gene and schizophrenia in Korean population using multiple single nucleotide polymorphism markers.
15370155 2004 The genetic basis for smoking behavior: a systematic review and meta-analysis.
15274029 2004 Association of the dopamine transporter gene (DAT1) core promoter polymorphism -67T variant with schizophrenia.
15229055 2004 Interacting effects of genetic predisposition and depression on adolescent smoking progression.
15211638 2004 Family-based and case-control association studies of DRD4 and DAT1 polymorphisms in Chinese attention deficit hyperactivity disorder patients suggest long repeats contribute to genetic risk for the disorder.
15210531 2004 Dopamine transporter loss visualized with FP-CIT SPECT in the differential diagnosis of dementia with Lewy bodies.
15202772 2004 Syntaxin 1A and receptor for activated C kinase interact with the N-terminal region of human dopamine transporter.
15193761 2004 The A9 allele of the dopamine transporter gene increases the risk of visual hallucinations during alcohol withdrawal in alcohol-dependent women.
15190232 Dopamine transporter gene polymorphism, spect imaging, and levodopa response in patients with Parkinson disease.
15148564 2004 Pharmacogenetic insights to monoaminergic dysfunction in alcohol dependence.
15135042 2004 alpha-Synuclein regulation of the dopaminergic transporter: a possible role in the pathogenesis of Parkinson's disease.
15094788 2004 Tourette syndrome and dopaminergic genes: a family-based association study in the French Canadian founder population.
15091313 2004 DAT polymorphism and diverse clinical manifestations in methamphetamine abusers.
15069467 2004 Eating disorders with binge-eating behaviour are associated with the s allele of the 3'-UTR VNTR polymorphism of the dopamine transporter gene.
15024426 2004 N-terminal phosphorylation of the dopamine transporter is required for amphetamine-induced efflux.
15024013 2004 The role of N-glycosylation in function and surface trafficking of the human dopamine transporter.
14978671 2004 Alteration in alpha-synuclein mRNA expression in Parkinson's disease.
14732864 2004 Stress-induced cigarette craving: effects of the DRD2 TaqI RFLP and SLC6A3 VNTR polymorphisms.
14732464 2004 Polymorphisms of dopamine receptor and transporter genes and hallucinations in Parkinson's disease.
14685824 2004 Association between polymorphism of the dopamine transporter gene and early smoking onset: an interaction risk on nicotine dependence.
14681904 2004 Role of dopamine D3 receptor (DRD3) and dopamine transporter (DAT) polymorphism in cognitive dysfunctions and therapeutic response to atypical antipsychotics in patients with schizophrenia.
14660644 2004 Aspartate 345 of the dopamine transporter is critical for conformational changes in substrate translocation and cocaine binding.
14597628 2004 Identification of intracellular residues in the dopamine transporter critical for regulation of transporter conformation and cocaine binding.
14584093 2003 Dopamine transporter genotype influences the attention deficit in Korean boys with ADHD.
14570538 2003 Effects of dopamine transporter and receptor polymorphisms on smoking cessation in a bupropion clinical trial.
14519759 2003 The human dopamine transporter forms a tetramer in the plasma membrane: cross-linking of a cysteine in the fourth transmembrane segment is sensitive to cocaine analogs.
12958153 2003 Modulation of dopamine transporter function by alpha-synuclein is altered by impairment of cell adhesion and by induction of oxidative stress.
12947560 2003 [Association studies of dopamine D4 receptor gene and dopamine transporter gene polymorphisms in Han Chinese patients with attention deficit hyperactivity disorder].
12931138 2003 Nine- or fewer repeat alleles in VNTR polymorphism of the dopamine transporter gene is a strong risk factor for prolonged methamphetamine psychosis.
12915833 2003 Role of dopamine transporter genotype and maternal prenatal smoking in childhood hyperactive-impulsive, inattentive, and oppositional behaviors.
12898575 2003 Association of the 480 bp DAT1 allele with methylphenidate response in a sample of Irish children with ADHD.
12874502 2003 Functional effects of the DAT1 polymorphism on EEG measures in ADHD.
12859681 2003 Na+ stimulates binding of dopamine to the dopamine transporter in cells but not in cell-free preparations.
12815660 2003 Lack of effect of polymorphisms in dopamine metabolism related genes on imaging of TRODAT-1 in striatum of asymptomatic volunteers and patients with Parkinson's disease.
12773538 2003 Evidence for distinct sodium-, dopamine-, and cocaine-dependent conformational changes in transmembrane segments 7 and 8 of the dopamine transporter.
12746456 2003 Oligomerization of dopamine transporters visualized in living cells by fluorescence resonance energy transfer microscopy.
12740596 2003 The dopamine transporter gene is associated with attention deficit hyperactivity disorder in a Taiwanese sample.
12708251 2003 [Distribution of DRD4 and DAT1 alleles from dopaminergic system in a mixed Chilean population].
12707943 2003 Association of the dopamine beta hydroxylase gene with attention deficit hyperactivity disorder: genetic analysis of the Milwaukee longitudinal study.
12707931 2003 5HTTLPR polymorphism in schizophrenic patients: further support for association with violent suicide attempts.
12686408 2003 The homozygote 10-copy genotype of variable number tandem repeat dopamine transporter gene may confer protection against Parkinson's disease for male, but not to female patients.
12672538 2003 Attenuation of dopamine transporter activity by alpha-synuclein.
12660802 2003 Linkage disequilibrium mapping at DAT1, DRD5 and DBH narrows the search for ADHD susceptibility alleles at these loci.
12658362 2003 Association study of the dopamine and serotonin transporter genetic polymorphisms and methamphetamine abuse in Chinese males.
12650952 2003 Investigating the role of dopaminergic and serotonergic candidate genes in obsessive-compulsive disorder.
12630565 2003 Genetic polymorphisms of serotonin and dopamine transporters in mental disorders.
12605102 2003 Association analysis for dopamine D3 receptor, dopamine D4 receptor and dopamine transporter genetic polymorphisms and P300 event-related potentials for normal young females.
12579508 2003 [Associations between six functional genes and schizophrenia].
12513948 2003 The A9 allele of the dopamine transporter gene is associated with delirium tremens and alcohol-withdrawal seizure.
12490667 2002 Dopamine transporter genotype as a risk factor for obesity in African-American smokers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.