Property Summary

NCBI Gene PubMed Count 702
PubMed Score 3495.06
PubTator Score 2895.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
osteosarcoma 7933 9.3644442726414E-6
group 4 medulloblastoma 1875 1.24356192545022E-4
malignant mesothelioma 3163 3.31121395801823E-4
diabetes mellitus 1663 0.0013315530188623
Disease Target Count Z-score Confidence
Dystonia 77 0.0 4.0
Neurodegenerative disease 383 0.0 4.0
Disease Target Count
Parkinsonism-dystonia infantile 1

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma 1.338 0.000
group 4 medulloblastoma 3.100 0.000
diabetes mellitus 1.200 0.001

Synonym

Accession Q01959 A2RUN4 Q14996 DA transporter
Symbols DAT
DAT1
PKDYS

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA Inparanoid

MLP Assay (20)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
449768 screening 1416 / 0 / 107003 High Throughput Screening for Cocaine Antagonists: Primary Screen
463084 summary 0 / 0 / 0 High Throughput Screening for Cocaine Antagonists
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504858 screening 529 / 0 / 762 High Throughput Screening for Cocaine Antagonists: Retest of Primary Hits
588389 other 169 / 0 / 1122 High Throughput Screening for Cocaine Antagonists:Counterscreen of Primary Hits
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (823)

PMID Text
27167478 Functional polymorphisms of the genes encoding adenosine A2A receptors and dopamine transporters contribute to individual differences in impaired sleep quality by caffeine.
26986136 3'-UTR variable number tandem repeat associated with post-traumatic stress disorder [meta-analysis]
26831905 high SLC6A3 expression in Clear cell renal cell carcinoma tissue was correlated with a shorter period of recurrence-free survival following surgery.
26786096 The NET and DAT N Termini Are Critical for Internalization and Postendocytic Sorting.
26621748 that the cdc42-activated, nonreceptor tyrosine kinase, Ack1, is a DAT endocytic brake that stabilizes DAT at the plasma membrane.
26593110 Study failed to observe a significant association of the SLC6A3 40-base pair variable number of tandem repeats polymorphism (rs28363170) with cognitive function in healthy adults
26504078 Zn(2+) dissociated more rapidly from the inward- than from the outward-facing state of DAT.
26478196 variations in the DAT1 gene may influence the amount of Dopamine availability and the experience of reward in both Substance use disorders and compulsive overeating.
26471374 DAT1 variants are associated with reaction time slops on a reflexive attention task.
26466362 HIV-1 Nef-mediated downregulation of HLA (MHCI) may be affected by/inhibited by SLC6A3 as demonstrated by siRNA genome-wide screen [in HeLa cells)
More...

AA Sequence

MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFL      1 - 70
LSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKG     71 - 140
VGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGT    141 - 210
TPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTAL    211 - 280
LLRGVTLPGAIDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTT    281 - 350
SINSLTSFSSGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI    351 - 420
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLI    421 - 490
EAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGAYIFPDWANAL    491 - 560
GWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQFTLRHWLKV              561 - 620
//

Text Mined References (704)

PMID Year Title
27167478 2016 [Self-rated Caffeine Sensitivity: Implications for Personalized Sleep Medicine?].
26986136 2016 The Association Between Genetic Variants in the Dopaminergic System and Posttraumatic Stress Disorder: A Meta-Analysis.
26831905 2016 Identification of the dopamine transporter SLC6A3 as a biomarker for patients with renal cell carcinoma.
26786096 2016 Differential Internalization Rates and Postendocytic Sorting of the Norepinephrine and Dopamine Transporters Are Controlled by Structural Elements in the N Termini.
26621748 2015 Ack1 is a dopamine transporter endocytic brake that rescues a trafficking-dysregulated ADHD coding variant.
26593110 2016 Meta-analysis of the association of the SLC6A3 3'-UTR VNTR with cognition.
26504078 2015 Dual Action of Zn2+ on the Transport Cycle of the Dopamine Transporter.
26478196 2015 Genetic Similarities between Compulsive Overeating and Addiction Phenotypes: A Case for "Food Addiction"?
26471374 2015 Genetic contributions to attentional response time slopes across repeated trials.
26442590 2015 Dopamine Transporter Activity Is Modulated by ?-Synuclein.
More...