Property Summary

NCBI Gene PubMed Count 13
PubMed Score 36.17
PubTator Score 7.74

Knowledge Summary

Patent

No data available

Gene RIF (6)

PMID Text
25023003 Mutations in SLC6A18 gene is associated with stress fracture.
21420947 These results suggest that SLC6A18 or neighboring genes are associated with increased susceptibility to myocardial infarction.
19692168 Observational study of gene-disease association. (HuGE Navigator)
18554081 variable number of tandem repeats in SLC6A18 are not associated with hypertension.
18554081 Observational study of gene-disease association. (HuGE Navigator)
16340170 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MAHAPEPDPAACDLGDERPKWDNKAQYLLSCTGFAVGLGNIWRFPYLCQTYGGGAFLIPYVIALVFEGIP      1 - 70
IFHVELAIGQRLRKGSVGVWTAISPYLSGVGLGCVTLSFLISLYYNTIVAWVLWYLLNSFQHPLPWSSCP     71 - 140
PDLNRTGFVEECQGSSAVSYFWYRQTLNITADINDSGSIQWWLLICLAASWAVVYMCVIRGIETTGKVIY    141 - 210
FTALFPYLVLTIFLIRGLTLPGATKGLIYLFTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNS    211 - 280
PRNDCQKDAVVIALVNRMTSLYASIAVFSVLGFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVL    281 - 350
MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAPVWAMLFFGMLFTLGLSTMFG    351 - 420
TVEAVITPLLDVGVLPRWVPKEALTGLVCLVCFLSATCFTLQSGNYWLEIFDNFAASPNLLMLAFLEVVG    421 - 490
VVYVYGMKRFCDDIAWMTGRRPSPYWRLTWRVVSPLLLTIFVAYIILLFWKPLRYKAWNPKYELFPSRQE    491 - 560
KLYPGWARAACVLLSLLPVLWVPVAALAQLLTRRRRTWRDRDARPDTDMRPDTDTRPDTDMRPDTDMR      561 - 628
//

Text Mined References (15)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
25023003 2014 Novel candidate genes putatively involved in stress fracture predisposition detected by whole-exome sequencing.
21420947 2011 Association study: SLC6A18 gene and myocardial infarction.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19478081 2009 Orphan transporter SLC6A18 is renal neutral amino acid transporter B0AT3.
19033659 2008 Iminoglycinuria and hyperglycinuria are discrete human phenotypes resulting from complex mutations in proline and glycine transporters.
18554081 2008 Analysis of VNTRs in the solute carrier family 6, member 18 (SLC6A18) and lack of association with hypertension.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
16340170 2006 A nonsense polymorphism (Y319X) of the solute carrier family 6 member 18 (SLC6A18) gene is not associated with hypertension and blood pressure in Japanese.
16125675 2005 The repertoire of solute carriers of family 6: identification of new human and rodent genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15286787 2004 Mutations in SLC6A19, encoding B0AT1, cause Hartnup disorder.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.