Property Summary

NCBI Gene PubMed Count 25
PubMed Score 22.61
PubTator Score 25.78

Knowledge Summary

Patent

No data available

Gene RIF (14)

PMID Text
27172637 results indicate a significant correlation between T132903C and C109869T single nucleotide polymorphisms in the insulin receptor and solute carrier family 6 member 14 amino acid transporter(SLC6A14) genes with idiopathic infertility in Persian males
26160208 SLC6A14 and 5-HTR2C polymorphisms are associated with food intake and nutritional status in children.
26106611 Very little is known about the role of SLC6A14 in PDAC and our results demonstrate that this target merits further investigation as a candidate transporter for functional imaging of pancreatic ductal adenocarcinoma .
22466613 Single nucleotide polymorphism in SLC6A14 gene is associated with cystic fibrosis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19876004 Observational study of gene-disease association. (HuGE Navigator)
18700007 The five gene transcripts (aldolase B, elafin, MST-1, simNIPhom and SLC6A14) were changed in patients with ulcerative colitis, and were related to the disease activity.
18599538 The SLC6A14 gene encodes the transport protein known as the beta-alanine carrier which, due to its broad substrate specificity, is likely to play an important role in absorption of essential nutrients and drugs.
15905073 The up-regulation of SLC6A14 may have a pathogenic role in colorectal neoplasms.
15331564 Observational study of gene-disease association. (HuGE Navigator)
15331564 association of the SLC6A14 gene locus with obesity.
14660752 Observational study of gene-disease association. (HuGE Navigator)
14660752 SLC6A14 gene is an interesting novel candidate for obesity because it encodes an amino acid transporter, which potentially regulates tryptophan availability for serotonin synthesis and thus possibly affects appetite control.

AA Sequence

MDKLKCPSFFKCREKEKVSASSENFHVGENDENQDRGNWSKKSDYLLSMIGYAVGLGNVWRFPYLTYSNG      1 - 70
GGAFLIPYAIMLALAGLPLFFLECSLGQFASLGPVSVWRILPLFQGVGITMVLISIFVTIYYNVIIAYSL     71 - 140
YYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPG    141 - 210
QLPSEQYWNKVALQRSSGMNETGVIVWYLALCLLLAWLIVGAALFKGIKSSGKVVYFTALFPYVVLLILL    211 - 280
VRGATLEGASKGISYYIGAQSNFTKLKEAEVWKDAATQIFYSLSVAWGGLVALSSYNKFKNNCFSDAIVV    281 - 350
CLTNCLTSVFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFWSILFFFMLLTLG    351 - 420
LDSQFASIETITTTIQDLFPKVMKKMRVPITLGCCLVLFLLGLVCVTQAGIYWVHLIDHFCAGWGILIAA    421 - 490
ILELVGIIWIYGGNRFIEDTEMMIGAKRWIFWLWWRACWFVITPILLIAIFIWSLVQFHRPNYGAIPYPD    491 - 560
WGVALGWCMIVFCIIWIPIMAIIKIIQAKGNIFQRLISCCRPASNWGPYLEQHRGERYKDMVDPKKEADH    561 - 630
EIPTVSGSRKPE                                                              631 - 642
//

Text Mined References (26)

PMID Year Title
27172637 Four Single Nucleotide Polymorphisms in INSR, SLC6A14, TAS2R38, and OR2W3 Genes in Association with Idiopathic Infertility in Persian Men.
26160208 2015 SLC6A14 and 5-HTR2C polymorphisms are associated with food intake and nutritional status in children.
26106611 2015 Transcriptomic and Immunohistochemical Profiling of SLC6A14 in Pancreatic Ductal Adenocarcinoma.
22466613 2012 Multiple apical plasma membrane constituents are associated with susceptibility to meconium ileus in individuals with cystic fibrosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19876004 2010 Obesity-related polymorphisms and their associations with the ability to regulate fat oxidation in obese Europeans: the NUGENOB study.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
18700007 2008 Five mucosal transcripts of interest in ulcerative colitis identified by quantitative real-time PCR: a prospective study.
18599538 2008 Human solute carrier SLC6A14 is the beta-alanine carrier.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17575980 2007 Differential expression of intestinal membrane transporters in cholera patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15905073 2005 Upregulation of the amino acid transporter ATB0,+ (SLC6A14) in colorectal cancer and metastasis in humans.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331564 2004 Polymorphisms in the amino acid transporter solute carrier family 6 (neurotransmitter transporter) member 14 gene contribute to polygenic obesity in French Caucasians.
14660752 2003 The SLC6A14 gene shows evidence of association with obesity.
14660737 2003 Do allelic variants of SLC6A14 predispose to obesity?
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388375 2003 Expression of the amino acid transporter ATB 0+ in lung: possible role in luminal protein removal.
10999806 2000 Genome-wide scan of obesity in Finnish sibpairs reveals linkage to chromosome Xq24.
10446133 1999 Cloning and functional expression of a human Na(+) and Cl(-)-dependent neutral and cationic amino acid transporter B(0+).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.