Property Summary

Ligand Count 61
NCBI Gene PubMed Count 58
PubMed Score 786.69
PubTator Score 192.74

Knowledge Summary


No data available


  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 0.9
Disease Target Count Z-score Confidence
Epilepsy 792 4.88 2.4
Disease Target Count Z-score Confidence
Lingual goiter 1 4.531 2.3
Glaucoma 239 4.44 2.2
Female stress incontinence 7 3.098 1.5
Disease Target Count
Myoclonic-astastic epilepsy 1


  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.200 3.9e-05
atypical teratoid / rhabdoid tumor -3.800 1.6e-08
ependymoma -2.000 5.2e-08
glioblastoma -2.100 1.0e-05
group 3 medulloblastoma -4.200 3.0e-08
medulloblastoma, large-cell -4.600 1.4e-07
osteosarcoma -1.530 1.6e-02
pancreatic ductal adenocarcinoma liver m... -1.266 3.2e-02
primitive neuroectodermal tumor -1.800 3.9e-03
type II diabetes mellitus and post-ische... 1.300 5.7e-03

Gene RIF (39)

AA Sequence

GSLKQRIQVMVQPSEDIVRPENGPEQPQAGSSTSKEAYI                                   561 - 599

Text Mined References (60)

PMID Year Title