Property Summary

NCBI Gene PubMed Count 37
PubMed Score 72.67
PubTator Score 58.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Colonic Neoplasms 126
Hyperuricemia 35
Disease Target Count P-value
lung carcinoma 2844 1.9e-04
Disease Target Count Z-score Confidence
Cancer 2346 3.064 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.200 1.9e-04

Gene RIF (32)

PMID Text
26285906 Data suggest that SLC5A8, SLC5A5 (sodium-iodide symporter), and SLC26A4 (pendrin), the 3 known iodide transporters, are important in breast tissue metabolism in lactation and in breast neoplasms. [REVIEW]
25827678 Gene silencing of SLC5A8 by hypermethylation was associated with poor prognosis in cases of node-negative stage I and II lung adenocarcinoma.
23918800 Data indicate oncogenic HRAS (HRAS(G12V)) as a potent mediator of SLC5A8 silencing in human nontransformed normal mammary epithelial cell lines and in mouse mammary tumors through DNMT1.
23273563 These results suggest that DNA methylation in the SLC5A8 promoter region may suppress the expression of SLC5A8 in lung tumor.
23167260 SLC5A8 suppresses tumour progression through depletion of survivin without involving its transport function
22450368 SLC5A8 nuclear translocation and loss of expression are associated with poor outcome in pancreatic ductal adenocarcinoma.
21802122 SLC5A8 has a role in prostate cancer risk and aggressiveness
21687703 SLC5A8 is highly methylated in African American colon adenomas
20965718 Observational study of gene-disease association. (HuGE Navigator)
20671196 Efficacy of LP or their secreted soluble factors to stimulate SMCT1 expression and function and to counteract the inhibitory effects of TNF-alpha on butyrate absorption could have potential therapeutic value.
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20211600 Sodium-coupled electrogenic transport of pyroglutamate (5-oxoproline) via SLC5A8, a monocarboxylate transporter.
20082847 results elucidate the mechanism underlying the regulation of SLC5A8 gene transcription and also define a novel regulatory sequence that may be used to increase expression of the SLC5A8 gene in cancer gene therapy
20029986 Results verify IRX1, EBF3, SLC5A8, SEPT9, and FUSSEL18 as valid methylation markers in two separate sets of HNSCC specimens; also preliminarily show a trend between HPV16 positivity and target gene hypermethylation of IRX1, EBF3, SLC5A8, and SEPT9.
19864324 SMCT1 possesses a anionic leak current that becomes significant whenever external Na(+) concentration is reduced
19730683 Observational study of gene-disease association. (HuGE Navigator)
18661192 SLC5A8 mediates the tumor-suppressive effects of the bacterial fermentation product butyrate in the colon
18566324 In acute myeloid leukemia with mixed lineage leukemia partial tandem duplication, the SLC5A8 tumor suppressor gene promoter was more frequently hypermethylated.
18559491 Frequent methylation of SLC5A8 gene is associated with head and neck squamous cell carcinoma
18437076 SLC5A8 may function as a tumor suppressor gene whose silencing may contribute to carcinogenesis and progression of pancreatic cancer.
18037591 DNA methylation in the SLC5A8 promoter region suppressed the expression of SLC5A8 in prostate tumor.
17692818 low-affinity transporter SMCT2 initiates lactate absorption in the early parts of the proximal tubule followed by the participation of the high-affinity transporter SMCT1 in the latter parts of the proximal tubule.
17526579 biophysical analysis of the stoichiometry for the Na+/monocarboxylate cotransporter SMCT1
17245649 SMCT1(SLC5A8) may participate in the intestinal absorption of monocarboxylate drugs.
16858683 Aberrant methylation and hence silencing of TIMP3, SLC5A8, DAPK and RARbeta2, in association with BRAF mutation, may be an important step in PTC tumorigenesis and progression.
16670197 Na(+)/monocarboxylate transport expression may be a favorable indicator of colorectal cancer prognosis
16375929 the ability of SLC5A8 to deliver butyrate into colonic epithelial cells most likely underlies the tumor suppressive role of this transporter [review]
15867356 Data suggest that SLC5A8 functions as a growth suppressor gene in vitro and that it is silenced frequently by epigenetic mechanisms in primary gliomas.
15001644 In thyroid carcinomas, the mean and median hAIT mRNA levels were significantly decreased
14966140 functional identity of SLC5A8 as a Na(+)-coupled transporter for short-chain fatty acids.
12829793 SLC5A8 exon 1 methylation is an early event, detectable in colon adenomas & microscopic aberrant crypt foci. SLC5A8 is a member of the family of sodium solute symporters, now added to the candidate colon cancer suppressor genes.
12107270 Identification and characterization of a putative human iodide transporter located at the apical membrane of thyrocytes. (hAIT, human apical iodide transporter)

AA Sequence

MDTPRGIGTFVVWDYVVFAGMLVISAAIGIYYAFAGGGQQTSKDFLMGGRRMTAVPVALSLTASFMSAVT      1 - 70
VLGTPSEVYRFGAIFSIFAFTYFFVVVISAEVFLPVFYKLGITSTYEYLELRFNKCVRLCGTVLFIVQTI     71 - 140
LYTGIVIYAPALALNQVTGFDLWGAVVATGVVCTFYCTLGGLKAVIWTDVFQVGIMVAGFASVIIQAVVM    141 - 210
QGGISTILNDAYDGGRLNFWNFNPNPLQRHTFWTIIIGGTFTWTSIYGVNQSQVQRYISCKSRFQAKLSL    211 - 280
YINLVGLWAILTCSVFCGLALYSRYHDCDPWTAKKVSAPDQLMPYLVLDILQDYPGLPGLFVACAYSGTL    281 - 350
STVSSSINALAAVTVEDLIKPYFRSLSERSLSWISQGMSVVYGALCIGMAALASLMGALLQAALSVFGMV    351 - 420
GGPLMGLFALGILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGCNSTYNETNLM    421 - 490
TTTEMPFTTSVFQIYNVQRTPLMDNWYSLSYLYFSTVGTLVTLLVGILVSLSTGGRKQNLDPRYILTKED    491 - 560
FLSNFDIFKKKKHVLSYKSHPVEDGGTDNPAFNHIELNSDQSGKSNGTRL                        561 - 610
//

Text Mined References (44)

PMID Year Title
26285906 2015 Iodide transport and breast cancer.
25827678 2015 Prognostic Significance of Aberrant Methylation of Solute Carrier Gene Family 5A8 in Lung Adenocarcinoma.
23918800 2013 Molecular mechanism of SLC5A8 inactivation in breast cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23273563 2013 Gene silencing of SLC5A8 identified by genome-wide methylation profiling in lung cancer.
23167260 2013 The plasma membrane transporter SLC5A8 suppresses tumour progression through depletion of survivin without involving its transport function.
22450368 2012 SLC5A8 nuclear translocation and loss of expression are associated with poor outcome in pancreatic ductal adenocarcinoma.
21802122 2011 Protein expressions and genetic variations of SLC5A8 in prostate cancer risk and aggressiveness.
21687703 2011 SLC5A8 gene, a transporter of butyrate: a gut flora metabolite, is frequently methylated in African American colon adenomas.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20671196 2010 The probiotic Lactobacillus plantarum counteracts TNF-{alpha}-induced downregulation of SMCT1 expression and function.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20211600 2010 Sodium-coupled electrogenic transport of pyroglutamate (5-oxoproline) via SLC5A8, a monocarboxylate transporter.
20082847 2010 Identification and characterization of the human SLC5A8 gene promoter.
20029986 2010 HPV status-independent association of alcohol and tobacco exposure or prior radiation therapy with promoter methylation of FUSSEL18, EBF3, IRX1, and SEPT9, but not SLC5A8, in head and neck squamous cell carcinomas.
19864324 2010 Anionic leak currents through the Na+/monocarboxylate cotransporter SMCT1.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18661192 2008 Sodium-coupled transport of the short chain fatty acid butyrate by SLC5A8 and its relevance to colon cancer.
18566324 2008 DNA hypermethylation and epigenetic silencing of the tumor suppressor gene, SLC5A8, in acute myeloid leukemia with the MLL partial tandem duplication.
18559491 2008 Frequently methylated tumor suppressor genes in head and neck squamous cell carcinoma.
18437076 2008 Silencing of the candidate tumor suppressor gene solute carrier family 5 member 8 (SLC5A8) in human pancreatic cancer.
18037591 2007 Candidate tumor suppressor gene SLC5A8 is frequently down-regulated by promoter hypermethylation in prostate tumor.
17692818 2007 Cloning and functional characterization of human SMCT2 (SLC5A12) and expression pattern of the transporter in kidney.
17526579 2007 Establishing a definitive stoichiometry for the Na+/monocarboxylate cotransporter SMCT1.
17245649 2007 Transport of nicotinate and structurally related compounds by human SMCT1 (SLC5A8) and its relevance to drug transport in the mammalian intestinal tract.
17178845 2006 SLC5A8 triggers tumor cell apoptosis through pyruvate-dependent inhibition of histone deacetylases.
16873376 2006 c/ebpdelta Null mouse as a model for the double knock-out of slc5a8 and slc5a12 in kidney.
16858683 2006 Association of aberrant methylation of tumor suppressor genes with tumor aggressiveness and BRAF mutation in papillary thyroid cancer.
16805814 2006 Identity of SMCT1 (SLC5A8) as a neuron-specific Na+-coupled transporter for active uptake of L-lactate and ketone bodies in the brain.
16729224 2006 Interaction of ibuprofen and other structurally related NSAIDs with the sodium-coupled monocarboxylate transporter SMCT1 (SLC5A8).
16670197 2006 Na(+)/monocarboxylate transport (SMCT) protein expression correlates with survival in colon cancer: molecular characterization of SMCT.
16541075 2006 The finished DNA sequence of human chromosome 12.
16375929 2006 SLC5A8 (SMCT1)-mediated transport of butyrate forms the basis for the tumor suppressive function of the transporter.
15867356 2005 Shared epigenetic mechanisms in human and mouse gliomas inactivate expression of the growth suppressor SLC5A8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361710 Aberrant methylation and histone deacetylation associated with silencing of SLC5A8 in gastric cancer.
15322102 2004 Expression of slc5a8 in kidney and its role in Na(+)-coupled transport of lactate.
15090606 2004 The human tumour suppressor gene SLC5A8 expresses a Na+-monocarboxylate cotransporter.
15001644 2004 Expression of the apical iodide transporter in human thyroid tissues: a comparison study with other iodide transporters.
14966140 2004 Functional identification of SLC5A8, a tumor suppressor down-regulated in colon cancer, as a Na(+)-coupled transporter for short-chain fatty acids.
12829793 2003 SLC5A8, a sodium transporter, is a tumor suppressor gene silenced by methylation in human colon aberrant crypt foci and cancers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107270 2002 Identification and characterization of a putative human iodide transporter located at the apical membrane of thyrocytes.