Property Summary

NCBI Gene PubMed Count 29
PubMed Score 929.69
PubTator Score 95.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical adenoma -1.045 1.6e-02
adrenocortical carcinoma -1.142 1.1e-04
interstitial cystitis -3.000 5.8e-06
ovarian cancer 1.100 3.7e-08
psoriasis -1.300 2.3e-09

Protein-protein Interaction (2)

MLP Assay (17)

AID Type Active / Inconclusive / Inactive Description
488975 screening 2634 / 0 / 303961 Primary cell-based screen for identification of compounds that inhibit the Choline Transporter (CHT)
488977 screening 1511 / 0 / 305084 Primary cell-based screen for identification of compounds that allosterically activate the Choline Transporter (CHT)
488996 summary 0 / 0 / 0 Summary of probe development for activators of the Choline Transporter (CHT)
488997 summary 0 / 0 / 0 Summary of probe development for inhibitors of the Choline Transporter (CHT)
493221 screening 1714 / 0 / 723 Confirmatory screen for compounds that inhibit the Choline Transporter (CHT)
493222 screening 94 / 0 / 2343 Counter screen assay of the parental HEK293 cells for compounds that inhibit the Choline Transporter (CHT)
504833 screening 2234 / 0 / 222 Confirmatory screen for compounds that activate the Choline Transporter (CHT)
504840 confirmatory 891 / 5 / 648 Dose responses of compounds that inhibit the Choline Transporter (CHT) - 5 point CRC
588401 confirmatory 274 / 1 / 118 Dose responses of compounds that inhibit the Choline Transporter (CHT) - 10 point CRC
602208 confirmatory 14 / 0 / 7 JHICC_CHT_Inh_3H uptake_CRC
More...

Gene RIF (19)

PMID Text
26161852 These data show that acute exposure of depolarized cells to insulin is coupled to transiently increased levels of CHT proteins at the cell surface, and that this is attenuated by chronic insulin exposure.
24666128 This study demonstrated a specific impairment in cognitive control associated with the Ile89Val polymorphism of SLC5A7.
23392663 In transgenic animals with a heterozygous deletion of the choline transporter there is impairment in performing sustained attention tasks.
23141292 Our findings compel consideration of mutations in SLC5A7 or its functional partners in relation to unexplained motor neuronopathies.
23132865 CHT1 forms a homo-oligomer on the cell surface in cultured cells.
22483273 [review] The critical role of CHT in maintaining cholinergic transmission indicates that it could be a target for therapeutic intervention to promote acetylcholine synthesis, the accomplishment of which has not been adequately addressed.
22483271 This mini-review discusses structural requirements for both organic cationic transporters OCT1 and OCT2 versus the blood-brain barrier choline transporter (BBBCHT) are discussed and compared.
22361880 Nedd4-2 mediated ubiquitination regulates the cell surface expression of CHT1 in HEK293 cells.
21337021 Polymorphic variation in the CHT1 gene can predict early, subclinical measures of carotid atherosclerosis.
21163949 overexpressed ChAT enhanced transcription of the CHT1 gene but not the VACHT gene
20490865 The colocalisation of CHT1 immunoreactivity with VAChT immunoreactivity in cholinergic enteric nerves in the human bowel thus suggests that CHT1 represents another marker of cholinergic nerves.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17005849 The charge/choline ratio of hCHT varies from 10e/choline at -80 mV to 3e/choline at -20 mV. Choline uptake & choline-induced current are Na+ & Cl- dependent. External protons reduce hCHT current, transport, & binding with a similar pKa of 7.4.
16876130 Observational study of gene-disease association. (HuGE Navigator)
16876130 CHT1 variation is related to differences in a distributed corticolimbic circuitry mediating behavioral and physiologic arousal.
15784779 Observational study of gene-disease association. (HuGE Navigator)
15090548 CHT1 binds to Par-4 and inhibits choline uptake when its incorporation is reduced on the cell surface
12406342 high-affinity choline transporter, choline transporter 1, in nerve fibers and epithelial cells in the human and rat skin supporting the pivotal role of this transporter in both the neuronal and non-neuronal cholinergic system of the skin.
12237312 Results describe the identification and functional characterization of a single nucleotide polymorphism in the high affinity choline transporter (CHT1) gene.

AA Sequence

MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYING      1 - 70
TAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMF     71 - 140
WAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGGLYSVAYTDVVQLFCIFVGLWISVPFALSHP    141 - 210
AVADIGFTAVHAKYQKPWLGTVDSSEVYSWLDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFG    211 - 280
CLVMAIPAILIGAIGASTDWNQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADS    281 - 350
SILSASSMFARNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ    351 - 420
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLT    421 - 490
NICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNK    491 - 560
EAFLDVDSSPEGSGTEDNLQ                                                      561 - 580
//

Text Mined References (29)

PMID Year Title
26161852 2015 Insulin Regulates the Activity of the High-Affinity Choline Transporter CHT.
24666128 2014 Disposed to distraction: genetic variation in the cholinergic system influences distractibility but not time-on-task effects.
23392663 2013 The presynaptic choline transporter imposes limits on sustained cortical acetylcholine release and attention.
23141292 2012 Defective presynaptic choline transport underlies hereditary motor neuropathy.
23132865 2012 Transmembrane topology and oligomeric structure of the high-affinity choline transporter.
22483273 2012 Choline transporter CHT regulation and function in cholinergic neurons.
22483271 2012 The blood-brain barrier choline transporter.
22361880 2012 The high-affinity choline transporter CHT1 is regulated by the ubiquitin ligase Nedd4-2.
21337021 2012 Polymorphic variation in choline transporter gene (CHT1) is associated with early, subclinical measures of carotid atherosclerosis in humans.
21163949 2011 Nuclear choline acetyltransferase activates transcription of a high-affinity choline transporter.
20490865 2010 Immunoreactivity for high-affinity choline transporter colocalises with VAChT in human enteric nervous system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17092608 2007 SEC14-like protein 1 interacts with cholinergic transporters.
17005849 2006 Na+, Cl-, and pH dependence of the human choline transporter (hCHT) in Xenopus oocytes: the proton inactivation hypothesis of hCHT in synaptic vesicles.
16876130 2006 Human choline transporter gene variation is associated with corticolimbic reactivity and autonomic-cholinergic function.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15784779 Heart rate variability is associated with polymorphic variation in the choline transporter gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15450352 2004 Comparative study of gene expression of cholinergic system-related molecules in the human spinal cord and term placenta.
15090548 2004 Par-4 inhibits choline uptake by interacting with CHT1 and reducing its incorporation on the plasma membrane.
14623932 2003 Expression of the high-affinity choline transporter CHT1 in rat and human arteries.
12969261 2003 The hemicholinium-3 sensitive high affinity choline transporter is internalized by clathrin-mediated endocytosis and is present in endosomes and synaptic vesicles.
12628461 2003 Expression of the high-affinity choline transporter CHT1 in epithelia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406342 2002 Expression of the high-affinity choline transporter, CHT1, in the neuronal and non-neuronal cholinergic system of human and rat skin.
12237312 2002 Single nucleotide polymorphism of the human high affinity choline transporter alters transport rate.
11294660 2001 Localization of the gene for distal hereditary motor neuronopathy VII (dHMN-VII) to chromosome 2q14.
11068039 2000 Functional characterization of the human high-affinity choline transporter.
11027560 2000 Molecular cloning of a human, hemicholinium-3-sensitive choline transporter.