Property Summary

NCBI Gene PubMed Count 18
PubMed Score 34.74
PubTator Score 81.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
gastric cancer 1.100 1.6e-03
malignant mesothelioma 1.800 6.7e-05
astrocytic glioma 1.100 3.8e-03
ependymoma 1.600 2.9e-02
psoriasis 1.400 3.0e-03
osteosarcoma -2.855 2.5e-06
atypical teratoid / rhabdoid tumor 2.000 1.2e-04
glioblastoma 1.200 1.7e-02
medulloblastoma, large-cell 1.600 2.4e-04
ulcerative colitis -1.217 1.9e-02
autosomal dominant Emery-Dreifuss muscul... 1.338 7.4e-03
juvenile dermatomyositis 1.325 4.5e-11
acute quadriplegic myopathy 1.477 4.3e-06
tuberculosis -1.600 6.5e-05
non-small cell lung cancer 1.190 5.7e-11
intraductal papillary-mucinous adenoma (... 1.100 2.2e-03
intraductal papillary-mucinous carcinoma... 1.700 1.1e-03
intraductal papillary-mucinous neoplasm ... 2.700 1.8e-03
lung cancer 2.000 2.8e-03
sarcoidosis 1.300 2.6e-02
pancreatic cancer 1.100 3.3e-05
Breast cancer 3.200 2.4e-02
subependymal giant cell astrocytoma 3.240 1.3e-02
lung adenocarcinoma 1.345 4.8e-04
invasive ductal carcinoma 1.052 4.3e-02
Alzheimer's disease 1.300 3.0e-02
Pick disease 1.700 1.5e-04
progressive supranuclear palsy 1.700 3.4e-02
acute myeloid leukemia -1.200 3.6e-02

Gene RIF (8)

PMID Text
25756525 Hypotonic stress causes a significant upregulation of SLC5A3 gene expression as detected by semiquantitative RT-PCR and Western blot analysis.
24944204 A kinetic model has been generated for the transport mechanism of SMIT2 allowing insight into the transport of members of the LeuT structural family at the millisecond timescale.
23207989 JAK2 contributes to the regulation of the myoinositol transporter SMIT.
20971364 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19198609 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19032932 Expression and/or function of SMIT2 may be reduced in diabetes mellitus, insulin resistance and polycystic ovary syndrome causing abnormal inositol meteabolism
17178845 Tumor cells silence SLC5A8 and convert pyruvate into lactate as complementary mechanisms to avoid pyruvate-induced cell death.

AA Sequence

MRAVLDTADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVTIGASLFVSNIGSEHFIGLAG      1 - 70
SGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLILYIFTKLS     71 - 140
VDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMIISIMEIGGF    141 - 210
EEVKRRYMLASPDVTSILLTYNLSNTNSCNVSPKKEALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQ    211 - 280
VIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFTDDIACINPEHCMLVCGSRAGCSNIA    281 - 350
YPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVV    351 - 420
ISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFA    421 - 490
YRAPECDQPDNRPGFIKDIHYMYVATGLFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKKNLVVKENCSP    491 - 560
KEEPYQMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDA    561 - 630
YSNGQAALMGEKERKKETDDGGRYWKFIDWFCGFKSKSLSKRSLRDLMEEEAVCLQMLEETRQVKVILNI    631 - 700
GLFAVCSLGIFMFVYFSL                                                        701 - 718
//

Text Mined References (19)

PMID Year Title
25756525 2015 Hypotonic activation of the myo-inositol transporter SLC5A3 in HEK293 cells probed by cell volumetry, confocal and super-resolution microscopy.
24944204 2014 The transport mechanism of the human sodium/myo-inositol transporter 2 (SMIT2/SGLT6), a member of the LeuT structural family.
23207989 2012 Down-regulation of the myoinositol transporter SMIT by JAK2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
19198609 2009 Genome-wide association of early-onset myocardial infarction with single nucleotide polymorphisms and copy number variants.
19032932 2009 Human sodium/inositol cotransporter 2 (SMIT2) transports inositols but not glucose in L6 cells.
17178845 2006 SLC5A8 triggers tumor cell apoptosis through pyruvate-dependent inhibition of histone deacetylases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10830953 2000 The DNA sequence of human chromosome 21.
9685419 1998 Transcription of the sodium/myo-inositol cotransporter gene is regulated by multiple tonicity-responsive enhancers spread over 50 kilobase pairs in the 5'-flanking region.
9612208 1998 Human Na(+)-myo-inositol cotransporter gene: alternate splicing generates diverse transcripts.
9441750 1997 The structural organization of the human Na+/myo-inositol cotransporter (SLC5A3) gene and characterization of the promoter.
8646889 1996 The 21q22.1 STS marker, VN02 (EST00541 cDNA), is part of the 3' sequence of the human Na+/myo-inositol cotransporter (SLC5A3) gene.
7789985 1995 The human osmoregulatory Na+/myo-inositol cotransporter gene (SLC5A3): molecular cloning and localization to chromosome 21.
1372904 1992 Cloning of the cDNa for a Na+/myo-inositol cotransporter, a hypertonicity stress protein.