Property Summary

Ligand Count 3
NCBI Gene PubMed Count 10
PubMed Score 46.09
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic -1.500 3.6e-04
atypical teratoid/rhabdoid tumor -1.500 1.5e-04
ependymoma -1.500 1.3e-09
glioblastoma -1.100 1.5e-03
group 4 medulloblastoma -1.500 1.4e-02
pediatric high grade glioma -1.600 4.5e-04
Pick disease -1.300 5.2e-03
primitive neuroectodermal tumor -1.100 2.0e-03
progressive supranuclear palsy -1.500 2.2e-02
subependymal giant cell astrocytoma -2.004 8.9e-03

Gene RIF (4)

AA Sequence

MESGTSSPQPPQLDPLDAFPQKGLEPGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFLAGGDMVWWPV      1 - 70
GASLFASNVGSGHFIGLAGSGAATGISVSAYELNGLFSVLMLAWIFLPIYIAGQVTTMPEYLRKRFGGIR     71 - 140
IPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITAVYTVAGGLAAVIYTDALQTLI    141 - 210
MLIGALTLMGYSFAAVGGMEGLKEKYFLALASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVLFGMSI    211 - 280
PSLWYWCTDQVIVQRTLAAKNLSHAKGGALMAAYLKVLPLFIMVFPGMVSRILFPDQVACADPEICQKIC    281 - 350
SNPSGCSDIAYPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHLRPRASEKELMIV    351 - 420
GRVFVLLLVLVSILWIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRTNEKGAFWGLISGLLL    421 - 490
GLVRLVLDFIYVQPRCDQPDERPVLVKSIHYLYFSMILSTVTLITVSTVSWFTEPPSKEMVSHLTWFTRH    491 - 560
DPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEK    561 - 630
GKEELPARAEAIIVSLEENPLVKTLLDVNLIFCVSCAIFIWGYFA                             631 - 675
//

Text Mined References (14)

PMID Year Title