Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.44
PubTator Score 7.12

Knowledge Summary


No data available


Gene RIF (4)

24573086 hSGLT5 is a sodium/mannose transporter that is blocked by phlorizin. Li(+) and H(+) ions were also able to drive mannose transport, and transport was electrogenic.
22212718 SGLT-5 as a kidney mannose transporter
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

AGDGQTPQKHAFWARVCGFNAILLMCVNIFFYAYFA                                      561 - 596

Text Mined References (14)

PMID Year Title
24573086 2014 Fingerprints of hSGLT5 sugar and cation selectivity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22212718 2012 Functional characterisation of human SGLT-5 as a novel kidney-specific sodium-dependent sugar transporter.
22127746 2010 Quantitative PCR tissue expression profiling of the human SGLT2 gene and related family members.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19237446 2009 A neural network model for constructing endophenotypes of common complex diseases: an application to male young-onset hypertension microarray data.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12748858 2004 The sodium/glucose cotransport family SLC5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.