Property Summary

NCBI Gene PubMed Count 85
PubMed Score 559.02
PubTator Score 321.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 2.200 5.7e-12
intraductal papillary-mucinous neoplasm ... 2.000 2.9e-02
lung cancer 1.900 1.0e-03
active Crohn's disease 1.255 4.0e-03
ulcerative colitis 1.900 3.4e-04
lung adenocarcinoma -1.200 1.2e-08
lung carcinoma -1.100 5.2e-11
Breast cancer -1.400 1.2e-05
ovarian cancer 1.300 1.4e-05

Protein-protein Interaction (2)

Gene RIF (64)

PMID Text
26945065 Although the similarity between the pf values of SGLT1 and aquaporin-1 makes a transcellular pathway plausible, it renders water pumping physiologically negligible because the passive flux would be orders of magnitude larger.
26377793 Data demonstrate a role for Per1 in the transcriptional regulation of NHE3 and SGLT1 in the kidney.
26316524 Elevated SGLT activity increases Na+ influx into myocytes and causes Na+ overload in type 2 diabetes.
26121582 Cardiac SGLTs, possibly SGLT1 in particular, appear to provide an important protective mechanism against ischemia-reperfusion injury by replenishing ATP stores in ischemic cardiac tissues.
26086341 phlorizin binding domains in sodium-glucose cotransporter family
25936754 CREB activation is essential for EGF-induced SGLT1 gene expression.
25711084 SGLT1 or GLUT2 interact with the cytoskeleton in the intestinal epithelium during hexose absorption.
25600494 Compound K induces SGLT1 expression and glucose uptake in differentiated intestinal Caco-2 cells.
24236070 SGLT1 mRNA and GLUT2 mRNA expression are reduced significantly in CACo-2 cells exposed to berry extracts.
24191006 The Na2 site is conserved in hSGLT1, the side chain of S392 and the backbone carbonyl of S393 are important in the first Na+ binding, and that Na+ binding to Na2 promotes binding to Na1 and also sugar binding.
24048166 Gglucose galactose malabsorption...analysis lead to the identification of 2 novel mutations...
23910014 SGLT1 and GLUT5 expression in the plasma membrane is regulated by TNFalpha, leading to alteration on sugar transport, suggesting that TNFalpha could be a physiological local regulator of nutrient absorption in response to an intestinal inflammatory status.
23874689 Delphinidin-3-glucoside protects against oxidized low-density lipoprotein-induced mitochondrial dysfunction in vascular endothelial cells via the sodium-dependent glucose transporter SGLT1.
23531874 Data indicate that IGF-1R and SGLT1 interact in HEK293 and MCF7 cells, and IGF-1R siRNA transfection results in down-regulation of SGLT1.
23418532 Results suggest that the use of MAP17 and SGLT1 markers may identify patients who are likely to exhibit a better response to treatments that boost oxidative stress in other cancer types.
23116249 in hSGLT1, pi-pi interaction between outer gate residues F101 and F453 contributes to holding the sugar in the occluded conformation after binding.
23010278 B-RAF upregulates SGLT1 activity, an effect requiring vesicle insertion into the cell membrane.
23008432 A seven-state kinetic model is established that describes the activity of SGLT1 up to a 2 ms time resolution.
22159627 SGLT1 overexpression, as examined by immunohistochemistry, is an independent biomarker for poor prognosis of patients with ovarian carcinoma.
22159082 Data suggest that "gate" residues in SGLT1 contribute directly to the coupling between substrate and Na+ transport
22004742 the structural basis of cotransporter water permeability
21406183 JAK2 upregulates SGLT1 activity which may play a role in the effect of JAK2 during ischemia and malignancy.
21190656 An independent estimation of the turnover rate for human SGLT1 expressed in Xenopus laevis oocytes, was obtained applying the ion-trap technique.
21156162 HPV18 E6 oncoprotein participates in the upregulation of SGLT1.
21080109 Expression of SGLT1 and EGFR in colorectal cancer tissues was higher than that in normal tissues and their expression related with clinical stage.
21048164 The role of SGLT1 and SGLT2 in renal glucose reabsorption, and the potential for targeting these transporters in diabetes there are discussed.
20980548 The role of SGLT1 and SGLT2 in renal glucose reabsorption are discussed.
20965718 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20564476 Polyphenols, phenolic acids and tannins from strawberry and apple are potent inhibitors of GLUT2 and SGLT1 at concentrations predicted after dietary ingestion.
20486940 Glucose-galactose malabsorption is life-threatening newborn diarrhea caused by mutations in the Na(+) /glucose cotransporter gene SLC5A1 that described herein.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20338844 This study indicates that the leak current associated with SGLT1 is mediated by a variety of monovalent cations, including cations that do not generate the conformational changes associated to the Na+ binding site used for cotransport.
20334581 These observations support a role for AMPK in the regulation of Na+-coupled glucose transport.
19509029 cardiac SGLT1 expression and/or function are regulated by insulin and leptin, and are perturbed in disease.
19115253 Protein kinase A-mediated phosphorylation of the transporter represents a further mechanism in the regulation of SGLT1-mediated glucose transport in epithelial cells
18853313 High SGLT1 expression in pancreatic adenocarcinomas significantly correlates with DFS & a trend was found for OS, especially in younger patients. High SGLT1 expression in primary tumors correlates with high Bcl-2 expression, not p53 expression.
18713983 activation of SGLT-1 by glucose protects from damages induced by TLR ligands, in human intestinal epithelial cells and in a murine model of septic shock.
18481997 Ongoing work is aimed at identifying the localization signals in the SGLT1 3'-UTR and the corresponding binding proteins.
18471079 this high-capacity functional assay should provide a means to identify novel and selective SGLT inhibitors
17983207 the native carrier ( sodium/D-glucose cotransporter 1)residues Gln at position 457 and Thr at position 460 reside in a hydrophilic access pathway extending 5-7 A into the membrane to which sugars as well as the sugar moiety of inhibitory glucosides bind
17903058 D28G mutation in 16 family members of a patient with typical presentation of congenital glucose-galactose malabsorption
17686765 RSC1A1 codes for a 67-kDa protein named RS1 that mediates transcriptional and post-transcriptional regulation of Na(+)-D-glucose cotransporter SGLT1.
17505558 Thioglycoside VII (2-hydroxymethyl-phenyl-1'-thio-beta-D-galacto-pyranoside) had a pronounced inhibitory effect on hSGLT1.
17495124 Data show that hSGLT1 does not transport any of the flavonoids and seems therefore not involved in their intestinal absorption.
17222499 These studies demonstrate the existence of different conformational states of the membrane-embedded transporter in its glucose-free form, as sodium-glucose-carrier complex and as sodium-phlorizin-carrier complex.
17153597 Results describe the effect of taurine on glucose transporter using heterologous expression of sodium-glucose transporter-1 (SGLT-1).
17130520 study examines the conformations of the Na(+)/glucose cotransporter during sugar transport using charge and fluorescence measurements
16860318 description of a novel feedback mechanism in apoptotic signaling pathway for SGLT-1-dependent cytoprotection; observation suggests new function for CD14 on enterocytes involving induction of caspase-dependent SGLT-1 activity which leads to cell rescue
16788146 hRS1 protein exhibits glucose-dependent, short-term inhibition of hSGLT1 and hOCT2 by inhibiting the release of vesicles from the trans-Golgi network.
16446504 results indicate that cysteine residues C255 and C511 form a disulfide bridge in human SGLT1 and that this disulfide bridge is involved in the conformational change of the free carrier
16327313 HIV-1 Tat induces Na-D-glucose symporter (SGLT-1) mis-sorting and inhibits glucose uptake in human enterocytes
16322051 water transport across the membrane can be explained by cotransport of water in the membrane proteins and that intracellular unstirred layers effects are minute
16300400 3 conformational states of SGLT1 differ in their packing density and surface hydrophobicity, reflecting the empty carrier, the d-glucose loaded carrier facing the outside of membrane and the complex of the outside-orientated carrier with phlorizin
16260652 SGLT-1 has a role in glucose uptake and in protecting intestinal epithelial cells against LPS-induced apoptosis and barrier defects
15904891 the large, hydrophilic loop near the carboxyl terminus of SGLT1 does not appear to play a major part in the binding of phlorizin
15885653 Thus, the C351A and C361A mutations might cause a global reorganization of the disulfide bonds of SGLT1.
15596535 Our results indicate that the major voltage-dependent step of the Na(+)/glucose transport cycle is the return of the empty carrier from inward to outward facing conformations.
15476411 Aspartate residue 454 of SGLT1 is critically important for normal trafficking of the protein to the plasma membrane.
15166308 Na+-coupled glucose transporter 1 (SGLT1) was regulated by neuronal cell expressed developmentally downregulated 4-2 (Nedd4-2) and serum- and glucocorticoid-inducible kinase 1 (SGK1)
14724758 Taken together, these data indicate that RSC1A1 modulates dynamin-dependent trafficking of intracellular vesicles containing hSGLT1 in Xenopus oocytes, and modulates PKC-dependent short-term regulation of this transporter.
12773314 Intracellular compartments containing SGLT1 are involved in the regulation of SGLT1 abundance at the apical cell surface.
12139397 Mutations of this gene protein (mapped to Chromosome 22) causes glucose-galactose malabsorption in infants. Sugar transport is impaired mainly because the mutant proteins are either truncated or are not targeted properly to the cell membrane.

AA Sequence

MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPI      1 - 70
GASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQR     71 - 140
IQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVI    141 - 210
MLVGSLILTGFAFHEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFI    211 - 280
FGMSILTLWYWCTDQVIVQRCLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSE    281 - 350
CEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEK    351 - 420
ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLI    421 - 490
LGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTKPIPDVHLYRLC    491 - 560
WSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKM    561 - 630
KMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA                                        631 - 664
//

Text Mined References (86)

PMID Year Title
26945065 2016 The Sodium Glucose Cotransporter SGLT1 Is an Extremely Efficient Facilitator of Passive Water Transport.
26377793 2015 Transcriptional regulation of NHE3 and SGLT1 by the circadian clock protein Per1 in proximal tubule cells.
26316524 2015 Intracellular Na+ Concentration ([Na+]i) Is Elevated in Diabetic Hearts Due to Enhanced Na+-Glucose Cotransport.
26121582 2015 Expression of SGLT1 in Human Hearts and Impairment of Cardiac Glucose Uptake by Phlorizin during Ischemia-Reperfusion Injury in Mice.
26086341 2015 Identification of phlorizin binding domains in sodium-glucose cotransporter family: SGLT1 as a unique model system.
25936754 2015 An essential role of cAMP response element-binding protein in epidermal growth factor-mediated induction of sodium/glucose cotransporter 1 gene expression and intestinal glucose uptake.
25711084 2014 [The interaction between SGLT1 or GLUT2 glucose transporter and the cytoskeleton in the enterocyte as well as Caco2 cell during hexose absorption].
25600494 2015 A gut microbial metabolite of ginsenosides, compound K, induces intestinal glucose absorption and Na(+) /glucose cotransporter 1 gene expression through activation of cAMP response element binding protein.
24236070 2013 Regulation of glucose transporter expression in human intestinal Caco-2 cells following exposure to an anthocyanin-rich berry extract.
24191006 2013 Functional identification and characterization of sodium binding sites in Na symporters.
24048166 2014 Bitterness of glucose/galactose: novel mutations in the SLC5A1 gene.
23910014 2013 TNF? regulates sugar transporters in the human intestinal epithelial cell line Caco-2.
23874689 2013 Delphinidin-3-glucoside protects against oxidized low-density lipoprotein-induced mitochondrial dysfunction in vascular endothelial cells via the sodium-dependent glucose transporter SGLT1.
23531874 2013 A kinase-independent biological activity for insulin growth factor-1 receptor (IGF-1R) : implications for inhibition of the IGF-1R signal.
23418532 2013 MAP17 and SGLT1 protein expression levels as prognostic markers for cervical tumor patient survival.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23116249 2012 The importance of being aromatic: ? interactions in sodium symporters.
23010278 2012 Stimulation of the Na(+)-coupled glucose transporter SGLT1 by B-RAF.
23008432 2012 Simulated annealing reveals the kinetic activity of SGLT1, a member of the LeuT structural family.
22159627 2012 Overexpression of SGLT1 is correlated with tumor development and poor prognosis of ovarian carcinoma.
22159082 2012 Bridging the gap between structure and kinetics of human SGLT1.
22004742 2011 The structural pathway for water permeation through sodium-glucose cotransporters.
21406183 2011 Stimulation of the glucose carrier SGLT1 by JAK2.
21190656 2011 Determination of the Na(+)/glucose cotransporter (SGLT1) turnover rate using the ion-trap technique.
21156162 2011 Regulation of Na(+)-coupled glucose carrier SGLT1 by human papillomavirus 18 E6 protein.
21080109 2011 Overexpression of SGLT1 and EGFR in colorectal cancer showing a correlation with the prognosis.
21048164 2011 Molecular determinants of renal glucose reabsorption. Focus on "Glucose transport by human renal Na+/D-glucose cotransporters SGLT1 and SGLT2".
20980548 2011 Glucose transport by human renal Na+/D-glucose cotransporters SGLT1 and SGLT2.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20564476 2010 Polyphenols and phenolic acids from strawberry and apple decrease glucose uptake and transport by human intestinal Caco-2 cells.
20486940 2011 Multiple sequence variations in SLC5A1 gene are associated with glucose-galactose malabsorption in a large cohort of Old Order Amish.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20338844 2010 The actual ionic nature of the leak current through the Na+/glucose cotransporter SGLT1.
20334581 2010 Regulation of Na+-coupled glucose carrier SGLT1 by AMP-activated protein kinase.
19509029 2009 SGLT1 is a novel cardiac glucose transporter that is perturbed in disease states.
19115253 2009 Protein kinase-A affects sorting and conformation of the sodium-dependent glucose co-transporter SGLT1.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18853313 2008 Expression of SGLT1, Bcl-2 and p53 in primary pancreatic cancer related to survival.
18713983 2008 Sodium-dependent glucose transporter-1 as a novel immunological player in the intestinal mucosa.
18481997 2008 Targeting of transcripts encoding membrane proteins in polarized epithelia: RNA-protein binding studies of the SGLT1 3'-UTR.
18471079 2008 A high-capacity membrane potential FRET-based assay for the sodium-coupled glucose co-transporter SGLT1.
18455122 2008 Survival of cancer cells is maintained by EGFR independent of its kinase activity.
17983207 2007 D-Glucose-recognition and phlorizin-binding sites in human sodium/D-glucose cotransporter 1 (hSGLT1): a tryptophan scanning study.
17903058 2007 D28G mutation in congenital glucose-galactose malabsorption.
17686765 2007 Tripeptides of RS1 (RSC1A1) inhibit a monosaccharide-dependent exocytotic pathway of Na+-D-glucose cotransporter SGLT1 with high affinity.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17505558 2007 Thioglycosides as inhibitors of hSGLT1 and hSGLT2: potential therapeutic agents for the control of hyperglycemia in diabetes.
17222499 2007 Ligand-mediated conformational changes and positioning of tryptophans in reconstituted human sodium/D-glucose cotransporter1 (hSGLT1) probed by tryptophan fluorescence.
17153597 2006 Characterization of taurine as inhibitor of sodium glucose transporter.
17130520 2006 Conformational dynamics of hSGLT1 during Na+/glucose cotransport.
16860318 2006 LPS/CD14 activation triggers SGLT-1-mediated glucose uptake and cell rescue in intestinal epithelial cells via early apoptotic signals upstream of caspase-3.
16788146 2006 RS1 (RSC1A1) regulates the exocytotic pathway of Na+-D-glucose cotransporter SGLT1.
16446504 2006 Identification of a disulfide bridge linking the fourth and the seventh extracellular loops of the Na+/glucose cotransporter.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322051 2006 Water transport by Na+-coupled cotransporters of glucose (SGLT1) and of iodide (NIS). The dependence of substrate size studied at high resolution.
16300400 2005 High-yield functional expression of human sodium/d-glucose cotransporter1 in Pichia pastoris and characterization of ligand-induced conformational changes as studied by tryptophan fluorescence.
16260652 2005 SGLT-1-mediated glucose uptake protects intestinal epithelial cells against LPS-induced apoptosis and barrier defects: a novel cellular rescue mechanism?
15904891 2005 Membrane topology of loop 13-14 of the Na+/glucose cotransporter (SGLT1): a SCAM and fluorescent labelling study.
15885653 2005 Cys351 and Cys361 of the Na+/glucose cotransporter are important for both function and cell-surface expression.
15596535 2005 Perturbation analysis of the voltage-sensitive conformational changes of the Na+/glucose cotransporter.
15476411 2004 Coupled sodium/glucose cotransport by SGLT1 requires a negative charge at position 454.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15166308 2004 Regulation of glucose transporter SGLT1 by ubiquitin ligase Nedd4-2 and kinases SGK1, SGK3, and PKB.
14724758 2003 Downregulation of the Na(+)- D-glucose cotransporter SGLT1 by protein RS1 (RSC1A1) is dependent on dynamin and protein kinase C.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12885248 2003 Functional asymmetry of the human Na+/glucose transporter (hSGLT1) in bacterial membrane vesicles.
12773314 2003 More than apical: Distribution of SGLT1 in Caco-2 cells.
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12488461 2002 The human plasma proteome: history, character, and diagnostic prospects.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139397 2002 Molecular basis for glucose-galactose malabsorption.
12082088 2002 Up-regulation of sodium-dependent glucose transporter by interaction with heat shock protein 70.
11406349 2001 A missense mutation in the Na(+)/glucose cotransporter gene SGLT1 in a patient with congenital glucose-galactose malabsorption: normal trafficking but inactivation of the mutant protein.
11131365 2000 Expression of glucose transporters in lactating human mammary gland epithelial cells.
10591208 1999 The DNA sequence of human chromosome 22.
10036327 1999 Missense mutations in SGLT1 cause glucose-galactose malabsorption by trafficking defects.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8567640 1996 Membrane topology of the human Na+/glucose cotransporter SGLT1.
8563765 1996 Defects in Na+/glucose cotransporter (SGLT1) trafficking and function cause glucose-galactose malabsorption.
8244393 1993 Assignment of the human Na+/glucose cotransporter gene SGLT1 to chromosome 22q13.1.
8195156 1994 Structure of the human Na+/glucose cotransporter gene SGLT1.
7823022 1994 'Active' sugar transport in eukaryotes.
7759499 1995 The development of Na(+)-dependent glucose transport during differentiation of an intestinal epithelial cell clone is regulated by protein kinase C.
2490366 1989 Homology of the human intestinal Na+/glucose and Escherichia coli Na+/proline cotransporters.
2008213 1991 Glucose/galactose malabsorption caused by a defect in the Na+/glucose cotransporter.