Property Summary

NCBI Gene PubMed Count 8
PubMed Score 169.60
PubTator Score 45.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.100 7.4e-20
ductal carcinoma in situ 1.200 1.5e-03
invasive ductal carcinoma 1.400 3.2e-04
lung adenocarcinoma 1.100 4.2e-08
non-small cell lung carcinoma 1.300 6.9e-27
psoriasis -1.300 8.5e-04

AA Sequence

MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILI      1 - 70
VVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISM     71 - 140
YLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQ    141 - 210
EQDRNYWLLQT                                                               211 - 221
//

Text Mined References (12)

PMID Year Title