Property Summary

NCBI Gene PubMed Count 32
PubMed Score 53.48
PubTator Score 50.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.300 3.8e-02
malignant mesothelioma -1.300 1.1e-04
posterior fossa group B ependymoma -1.600 1.3e-11
psoriasis -1.600 9.2e-05
osteosarcoma 2.512 5.2e-03
glioblastoma 2.200 1.8e-04
group 4 medulloblastoma 1.800 2.5e-04
astrocytoma -1.500 1.0e-02
atypical teratoid / rhabdoid tumor 1.100 4.5e-03
medulloblastoma, large-cell 1.500 3.8e-05
primitive neuroectodermal tumor 1.100 2.1e-03
intraductal papillary-mucinous carcinoma... 1.300 2.5e-02
lung cancer 1.200 8.1e-04
sarcoidosis 1.500 1.3e-02
pediatric high grade glioma 2.000 4.8e-06
pilocytic astrocytoma 1.100 4.2e-06
non primary Sjogren syndrome sicca -1.500 2.3e-02
subependymal giant cell astrocytoma 1.524 1.8e-02
Endometriosis -1.983 6.7e-03
Breast cancer -1.700 2.0e-08
gastric carcinoma 1.100 1.6e-02
invasive ductal carcinoma 1.100 6.7e-03
Gaucher disease type 3 -1.500 3.2e-02
pituitary cancer -1.200 3.1e-05

 GWAS Trait (1)

Gene RIF (18)

PMID Text
25249183 A meta-analysis of genome-wide association studies of blood pressure and hypertension in Chinese identified three new loci (CACNA1D, CYP21A2, and MED13L) and a newly discovered variant near SLC4A7.
25241983 We demonstrate, for the first time, that 3 different pHi regulators responsible for acid extruding, i.e. NHE and NBC, and MCT, are functionally co-existed in cultured radial artery smooth muscle cells.
24788003 Upregulation of NBCn1 during human breast carcinogenesis contributes to the characteristic acid distribution within human breast carcinomas.
23117855 The SLC4A7 variant rs4973768 is associated with breast cancer risk.
22907202 Na(+),HCO(3)(-)-cotransport is a major determinant of pH(i) in breast cancer.
22383045 Simultaneous switching of the putative transmembrane segment (TM6) and TM12 of NBCe1 for those from NBCn1 severely impairs the expression of the transporter at the plasma membrane.
22120673 Data show that DeltaNErbB2 expression elicited Na(+), HCO(3)(-) cotransporter NBCn1 upregulation, Ser(703)-phosphorylation of Na(+)/H(+) exchanger NHE1.
21224233 The present study generated a series of chimeras of human NBCe1-A and human NBCn1-A (SLC4A7). Replacing the fourth extracellular loop (EL4) of human NBCe1-A with EL4 of NBCn1-A creates an electroneutral NBC.
20542029 NBCn1 inhibition attenuated cathepsin release and had no net effect on viability of MCF7 cells.
20145138 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19330027 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of solute carrier family 4, sodium bicarbonate cotransporter, member 7 (SLC4A7) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17624982 Observational study of gene-disease association. (HuGE Navigator)
17624982 Results suggest that SLC4A7 allelic variants might alter dispositions and/or excretion of drugs and neurotransmitters in brain and periphery in ways that could contribute to differential vulnerabilities to addictions.
14736710 NBC3 and CAII interact to maximize the HCO(3)(-) transport rate. Although PKA decreased NBC3 transport activity, it did so independently of the NBC3/CAII interaction and did not involve phosphorylation of NBC3Ct.
14578046 structural and functional study
12403779 The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the bicarbonate salvage trransporter isoform 3

AA Sequence

MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHRHRGHKHHHRR      1 - 70
RKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELCYRDGEEYEWKETARWLKFEE     71 - 140
DVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVRE    141 - 210
ALLKRHHHQNEKRFTSRIPLVRSFADIGKKHSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSL    211 - 280
LLGHLLPSSRAGTPAGSRCTTPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHP    281 - 350
PEEDLEAALKGEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMR    351 - 420
KIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQYHEIGRSIAT    421 - 490
LMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKSVPSQEKRKIPVFHNGSTPTL    491 - 560
GETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDFKDALSLQCLASILFLYCACMSPVITFGGLL    561 - 630
GEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWT    631 - 700
SFLCIVLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTE    701 - 770
PPNPSNETLAQWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSS    771 - 840
FLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGWIISPLGDNPW    841 - 910
WTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGVMLGVCSVMGLPWFVAATVLS    911 - 980
ISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMGLSVFMTSVLKFIPMPVLYGVFLYMGVSSLK    981 - 1050
GIQLFDRIKLFGMPAKHQPDLIYLRYVPLWKVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRK   1051 - 1120
LMDLCFTKRELSWLDDLMPESKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPD   1121 - 1190
KPVSVKISFEDEPRKKYVDAETSL                                                 1191 - 1214
//

Text Mined References (44)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25241983 2014 Functional characterization of intracellular pH regulators responsible for acid extrusion in human radial artery smooth muscle cells.
24788003 2015 Na+,HCO3- -cotransport is functionally upregulated during human breast carcinogenesis and required for the inverted pH gradient across the plasma membrane.
24493630 2014 A genome-wide association study of early-onset breast cancer identifies PFKM as a novel breast cancer gene and supports a common genetic spectrum for breast cancer at any age.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23117855 2012 The SLC4A7 variant rs4973768 is associated with breast cancer risk: evidence from a case-control study and a meta-analysis.
22907202 2013 Contribution of Na+,HCO3(-)-cotransport to cellular pH control in human breast cancer: a role for the breast cancer susceptibility locus NBCn1 (SLC4A7).
22383045 2012 Effect of simultaneously replacing putative TM6 and TM12 of human NBCe1-A with those from NBCn1 on surface abundance in Xenopus oocytes.
22120673 2012 The Na+/H+ exchanger NHE1, but not the Na+, HCO3(-) cotransporter NBCn1, regulates motility of MCF7 breast cancer cells expressing constitutively active ErbB2.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21263130 2011 Novel breast cancer susceptibility locus at 9q31.2: results of a genome-wide association study.
21224233 2011 Role of an extracellular loop in determining the stoichiometry of Na+-HCO?? cotransporters.
20542029 2010 NBCn1 and NHE1 expression and activity in DeltaNErbB2 receptor-expressing MCF-7 breast cancer cells: contributions to pHi regulation and chemotherapy resistance.
20453838 2010 Genome-wide association study identifies five new breast cancer susceptibility loci.
20145138 2010 Common genetic variants associated with breast cancer and mammographic density measures that predict disease.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19448079 2009 Modular structure of sodium-coupled bicarbonate transporters.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19330027 2009 Newly discovered breast cancer susceptibility loci on 3p24 and 17q23.2.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17624982 2007 Variation in a bicarbonate co-transporter gene family member SLC4A7 is associated with propensity to addictions: a study using fine-mapping and three samples.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16301216 2005 Scaffold protein harmonin (USH1C) provides molecular links between Usher syndrome type 1 and type 2.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14736710 2004 Regulation of the human NBC3 Na+/HCO3- cotransporter by carbonic anhydrase II and PKA.
14578046 Structural and functional characterization of the human NBC3 sodium/bicarbonate co-transporter carboxyl-terminal cytoplasmic domain.
12444018 2003 The COOH termini of NBC3 and the 56-kDa H+-ATPase subunit are PDZ motifs involved in their interaction.
12403779 2002 The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the HCO3- salvage transporter human Na+-HCO3- cotransport isoform 3.
10600945 1999 NBC3 expression in rabbit collecting duct: colocalization with vacuolar H+-ATPase.
10347222 1999 Cloning, tissue distribution, genomic organization, and functional characterization of NBC3, a new member of the sodium bicarbonate cotransporter family.
10198178 1999 Mapping of the human NBC3 (SLC4A7) gene to chromosome 3p22.
9610397 1998 Molecular cloning of a new sodium bicarbonate cotransporter cDNA from human retina.