Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.65
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0

Expression

Gene RIF (2)

PMID Text
25197798 Structural insights into the recognition of phosphopeptide by the FHA domain of kanadaptin
15764369 human kanadaptin did not interact with kidney anion exchanger 1 (kAE1) and had no effect on trafficking of kAE1 to the plasma membrane

AA Sequence

MLAPLRNAPGREGATSPSPPTDATGSLGEWDVDRNVKTEGWVSKERISKLHRLRMADILSQSETLASQDL      1 - 70
SGDFKKPALPVSPAARSKAPASSSSNPEEVQKEGPTALQDSNSGEPDIPPPQPDCGDFRSLQEEQSRPPT     71 - 140
AVSSPGGPARAPPYQEPPWGGPATAPYSLETLKGGTILGTRSLKGTSYCLFGRLSGCDVCLEHPSVSRYH    141 - 210
AVLQHRASGPDGECDSNGPGFYLYDLGSTHGTFLNKTRIPPRTYCRVHVGHVVRFGGSTRLFILQGPEED    211 - 280
REAESELTVTQLKELRKQQQILLEKKMLGEDSDEEEEMDTSERKINAGSQDDEMGCTWGMGEDAVEDDAE    281 - 350
ENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHS    351 - 420
GKKKEAMIQCSLEACRILDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLIEKKRLNRMKKAG    421 - 490
KIDEKPETFESLVAKLNDAERELSEISERLKASSQVLSESPSQDSLDAFMSEMKSGSTLDGVSRKKLHLR    491 - 560
TFELRKEQQRLKGLIKIVKPAEIPELKKTETQTTGAENKAKKLTLPLFGAMKGGSKFKLKTGTVGKLPPK    561 - 630
RPELPPTLMRMKDEPEVEEEEEEEEEEEKEKEEHEKKKLEDGSLSRPQPEIEPEAAVQEMRPPTDLTHFK    631 - 700
ETQTHENMSQLSEEEQNKDYQDCSKTTSLCAGPSASKNEYEKSRGELKKKKTPGPGKLPPTLSSKYPEDD    701 - 770
PDYCVWVPPEGQSGDGRTHLNDKYGY                                                771 - 796
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25197798 2014 Structural insights into the recognition of phosphopeptide by the FHA domain of kanadaptin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22159054 2011 A comprehensive genetic association study of Alzheimer disease in African Americans.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17553790 2007 Interaction of integrin-linked kinase with the kidney chloride/bicarbonate exchanger, kAE1.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15764369 Human kanadaptin and kidney anion exchanger 1 (kAE1) do not interact in transfected HEK 293 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12800979 2003 Mitochondrial and nuclear localization of kanadaptin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11934690 2002 Impaired trafficking of distal renal tubular acidosis mutants of the human kidney anion exchanger kAE1.
11772400 2002 Signal- and importin-dependent nuclear targeting of the kidney anion exchanger 1-binding protein kanadaptin.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9422766 1998 Kanadaptin is a protein that interacts with the kidney but not the erythroid form of band 3.
8570611 1996 Analysis of differential gene expression by display of 3' end restriction fragments of cDNAs.