Property Summary

NCBI Gene PubMed Count 253
PubMed Score 1271.75
PubTator Score 1046.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
osteosarcoma 7933 5.5e-06
psoriasis 6685 3.6e-04
mucosa-associated lymphoid tissue lymphoma 480 6.4e-03
tuberculosis 1563 2.2e-02
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 31 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 3.6e-04
osteosarcoma -5.437 5.5e-06
tuberculosis 1.900 2.2e-02
mucosa-associated lymphoid tissue lympho... 4.441 6.4e-03

Synonym

Accession P02730 G4V2I6 P78487 Q1ZZ45 Q4KKW9 Q4VB84 Q9UCY7 Q9UDJ1
Symbols DI
FR
SW
WD
WR
AE1
CHC
SAO
WD1
BND3
EPB3
SPH4
CD233
EMPB3
RTA1A

Gene

PANTHER Protein Class (1)

PDB

1BH7   1BNX   1BTQ   1BTR   1BTS   1BTT   1BZK   1HYN   2BTA   2BTB   3BTB   4KY9   4YZF  

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (164)

PMID Text
26542571 this study reports the crystal structure of the band 3 anion exchanger domain (AE1(CTD)) at 3.5 angstroms.
26047685 The evolutionary origin of Southeast Asian Ovalocytosis, characterizing DNA sequence variation around the causal mutation in the SLC4A1 gene.
25957428 This study is considered as a pilot study showing the importance of AE1 mutations in Iranian children with DRTA.
25628009 The authors demonstrate that the initial vacuolar membrane around internalized Babesia divergens is formed from protein and lipid components of the red blood cells plasma membrane, including band 3, glycophorin A and spectrin.
25616663 Kidney AE1 actually associates with epithelial ankyrin-G and renal ammonium transporter RhBG, which also binds ankyrin-G.
25388786 Partial pyruvate kinase deficiency aggravates the phenotypic expression of band 3 deficiency in a family with hereditary spherocytosis.
25344524 Deficiency in Band 3 is associated with Hereditary Spherocytosis.
25257781 Results indicate that Tryptophan residues play differential roles in AE1 expression and function depending on their location in the protein and that Trp mutants with low expression are misfolded and retained in the endoplasmic reticulum.
25012180 Activities of AE1 and the sodium pump are coregulated in kidney.
24964668 In 12% of our thalassemia major patients, we found two bands in the agarose gel-electrophoresis of PCR products from band 3 gene with a difference of 65 +/- 10 bp, equivalent to a deletion of 20 to 25 amino acids in band 3 protein.
24920676 kidney AE1 G701D mutant which accumulates predominantly in the Golgi and partially in the endoplasmic reticulum, is prematurely degraded by the lysosome and the proteasome.
24758720 The study reports the refinement for a protein heterodimer complex using limited EPR spectroscopic data and a rigid-body docking algorithm: a three-dimensional model for an ankyrin 1-BND3 complex.
24252324 SLC4A1 gene was a poor candidate for screening as our patients presented severe metabolic acidosis early in life.
24121512 A substrate access tunnel in the cytosolic domain is not an essential feature of the solute carrier 4 (SLC4) family of bicarbonate transporters.
23878048 A heterozygous SLC4A1(E508K) mutation (gene encoding erythrocyte membrane protein band 3) was found.
23846695 analysis of anion exchanger 1 (SLC4A1) transmembrane segments that form the transport site
23842529 Stopped-flow led to measurement of rapid transport kinetics using the natural substrate for AE1.
23583773 Study developed a three-dimensional homology model of the AE1 membrane domain, using the Escherichia coli ClC channel structure as a template and conclude that AE1 has a similar protein fold to ClC chloride channels.
23460825 Trafficking of intracellularly retained distal renal tubular acidosis kAE1 mutants can be partially restored.
23255290 description of 15 previously unknown mutations in SLC4A1 in hereditary spherocytosis patients; this genetic association study was conducted in the Netherlands [LETTER]
23219802 Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains
23013433 Deoxygenation of erythrocytes results in displacement of ankyrin from band 3 in the cytoskeleton.
22919024 Results suggest that mutations in this gene cause morphological changes in erythrocytes and these may afford some protection against malaria
22861190 Residues 63-73 of cdB3 is also essential for ankyrin binding.
22609520 1st report of distal renal tubular acidosis patients with compound heterozygous conditions in mainland China. 2 novel SLC4A1 mutations (G494S & D905dup) were identified.
22580993 a thiol-mediated and energy-dependent membrane transport of selenium by erythroid anion exchanger 1
22518001 Mutation conferring apical-targeting motif on AE1 exchanger causes autosomal dominant distal renal tubular acidosis.
22426110 There is evidence that Southeast Asian ovalocytosis (SAO) erythrocytes are resistant to multiple Plasmodium species. Here we analyze SLC4A1 in 23 primates and mammals to test for differential selective pressures among different primate lineages.
22214711 Hyperfibrinogenemia interferes with erythrocyte NO mobilization without changing its efflux in a way that depends on the degree of band 3 phosphorylation. At higher fibrinogen concentrations, NO efflux is reinforced when band 3 is phosphorylated.
22170767 These data indicate that de novo mutations in the band 3 gene are found associated with human genetic disease more commonly than previously recognized
22155194 Arg 901 in the AE1 C-terminal tail is involved in conformational change but not in substrate binding.
22126643 analysis of SLC4A1 A858D mutation in a homozygous state in renal tubular acidosis (dRTA) in association with membrane defect hemolytic anemia
21871436 KIF3B is involved in the trafficking of kAE1 to the plasma membrane of human kidney alpha-intercalated cells.
21761435 partial SLC-A1 deficiency: 12-year-old boy hospitalized for chronic compensated hemolytic anemia, with asthenia as major complaint; erythrocytes exhibit bizarre shapes (poikilocytosis) [single CASE REPORT]
21695904 The level of band 3 protein was positively correlated with physical activity and negatively correlated with systolic blood pressure.
21649639 These results suggest that AE1 is potentially a key therapeutic target and the silencing of AE1 expression in gastric mucosa could provide a new therapeutic approach for treating gastric cancer.
21543742 Data suggest that association of functional CAII with AE1 increases Cl(-)/HCO(3)(-) exchange activity, consistent with the HCO(3)(-) transport metabolon model.
21527529 data are consistent with assembly of major components of the band 3 macrocomplex at an early stage during erythropoiesis
21493712 Determination of structural models of the complex between the cytoplasmic domain of erythrocyte band 3 and ankyrin-R repeats 13-24.
21455273 Data suggest that glycophorin A (Gpa) increases expression and activity of Cl-/HCO3- exchanger Ae1, that G719D mutation renders Ae1 mutant constructs GPA-unresponsive, and suggests a role for Ae1 amino acids 22-28 in GPA responsiveness.
21300752 a H+ microdomain 0.3 mum in diameter forms around GFP.AE1 during physiological HCO3- transport
21257764 Dual transport properties of anion exchanger 1: the same transmembrane segment is involved in anion exchange and in a cation leak.
21246053 results show that treatment of G6PD deficient red cells with diamide (0.25 mM) or divicine (0.5 mM) causes: progressive recruitment of phosphorylated AE1 in large membrane complexes which also contain hemichromes
21209359 These observations, although not defining the mechanism of the red cell cation leak associated with AE1 R730C, document the importance of residue R730 to the anion translocation pathway of AE1 and its regulation.
21039340 study shows that cytoplasmic hereditary spherocytosis mutants cause impaired binding of protein 4.2 to AE1, leaving protein 4.2 susceptible to loss during erythrocyte development
20960171 A novel 1-bp duplication at nucleotide 2713 (c.2713dupG, band 3 Qingdao) in exon 20 of SLC4A1 in an autosomal dominant distal renal tubular acidosis family was identified.
20932077 Application of real-time PCR and melting curve analysis in rapid Diego blood group genotyping.
20932077 Observational study of genetic testing. (HuGE Navigator)
20833140 AP-1 mu1A is involved in the kAE1 trafficking of kidney alpha-intercalated cells.
20828148 provide two distance constraints for the position of Q434, which is located in extracellular loop 1, connecting the first two transmembrane segments of AE1
20825599 The frequencies of DI1 and DI2 alleles in the Chinese Han population were 0.0247 and 0.9753, respectively. Six new single nucleotide polymorphisms (SNPs) were found in the sequenced regions of the SLC4A1 gene.
20825599 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
20799361 2 unrelated Indian patients with combined hemolytic anemia and dRTA had homozygous A858D mutations of the AE1/SLC4A1 gene. The mutation creates a novel restriction site.
20691413 single-nucleotide polymorphisms and haplotypes in SLC4A1 in blacks are significantly associated with preeclampsia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628050 Cell surface rescue of kidney anion exchanger 1 mutants by disruption of chaperone interactions.
20576809 podocyte protein kidney anion exchanger 1 interacts with nephrin and kinase to maintain the structure and function of the glomerular basement membrane.
20561513 an increase in band 3 and its degradation products was found in senescent erythrocytes; evidence about protein modifications occurring during the RBC lifespan
20424473 Observational study of gene-disease association. (HuGE Navigator)
20346715 This review explores what is known about the erythrocyte membrane protein band 3 complexes of mice and humans, focussing on the observed species differences and their potential functional consequences.
20151848 Impaired trafficking of the kAE1 G701D and A858D mutants would lead to a profound decrease in functional kAE1 at the basolateral membrane of alpha-intercalated cells in the distal nephron of the patients with distal renal tubular acidosis.
20132789 Data suggest that His 834 of Band 3 is critically important for the efficient binding of sulfate anion, but not for the conformational change induced by substrate binding.
20100494 Electron microscopy was used to solve the three-dimensional structure of the AE1 membrane domain, fixed in an outward-open conformation by cross-linking, at 7.5-A resolution.
20068363 Distal renal tubular acidosis in Filipino children was associated with mutations of the SLC4A1 gene that codes for bicarbonate/chloride anion-exchanger 1 protein in the red cell membrane and in the proton-secreting cell of the renal collecting duct.
20062076 regulation of miR-24-related AE1 expression in gastric carcinogenesis and erythropoiesis.
20035734 Observational study of genetic testing. (HuGE Navigator)
20015879 These results suggest that cross-talk between the mutated Anion Exchange Protein 1 (band 3 protein) and other transporters might increase the cation permeability in cryohydrocytosis.
20007969 Data suggest that one or both of proteins 4.1 and 4.2 cause a portion of band 3 to localize near the spectrin-actin junctions and provide another point of attachment between the membrane skeleton and the lipid bilayer.
20005958 3D density map revealed that hB3MD consists of at least two subdomains and that the outward-open form is characterized by a large hollow area on the extracellular surface and continuous density on the intracellular surface.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19907019 Heterozygous missense mutation E758K in the human AE1/SLC4A1/band 3 gene in two unrelated patients with well-compensated hereditary spherostomatocytic anemia induces glycophorin A-independent, endogenous cation transport.
19846781 These data provide direct evidence supporting the role of band 3 in mediating oxygen-regulated metabolic transitions.
19722686 AE1 is responsible for the membrane transport of selenium.
19625994 the compound E522K/G701D mutation of human anion exchanger 1 causes a trafficking defect in kidney cells
19564639 Mi.III enhances the expression of band 3
19460752 Knockdown of solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group; SLC4A1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19438409 AE1 and GPA form a complex in the endoplasmic reticulum of human K562 cells.
19330352 Overexpression of anion exchanger 1 is associated with tumor progression in human gastric cancer.
19294450 Data conclude that an erythrocyte G protein with subunits Galphai1/2 and Gbeta is associated with band 3. AChE depends on the degree of band 3 phosphorylation and its association with Galphai1/2 and Gbeta.
19289107 The clustering of cation-leaky AE1 mutations to malarious areas of SE Asia suggests that they may confer malaria resistance.
19238475 The findings led us to formulate a hypothesis about the metabolic characteristics of beta-thalassemic erythrocytes, outlining that one of the main targets of caspase 3 in RBCs is the cytoplasmic domain of band 3 protein.
19229254 Approximately 5 kb of SLC4A1 in an Indonesian population where Southeast Asian ovalocytosis is prevalent was resequenced to better understand the evolution of this clinically important trait.
19229254 Observational study of genotype prevalence. (HuGE Navigator)
19071041 GPA depletion does not alter band 3's native conformation at the DIDS binding site. It modulates a conformational equilibrium between 2 states of the binary complex formed by the competitive inhibitor DIDS, reversibly bound to properly folded band 3.
19029645 Changes on human erythrocyte NOx mobilization and metabolic fluxes occur under influence of non-neuronal ACh/AChE, in turn dependent on the degree of band 3-phosphorylation.
18979639 Observational study of gene-disease association. (HuGE Navigator)
18945214 Selective tyrosine phosphorylation of oxidized band 3 by Syk may play a role in the recruitment of oxidized band 3 in large membrane aggregates that show a high affinity to NAbs, leading to RBC removal from the circulation.
18778682 Effect of glycyrrhetic acid on BND3 in erythrocytes is reported. It is proposed to strengthen membrane integrity against both oxidative and proteolytic damage.
18714043 CLL cells can specifically bind, capture, and present B3 to T cells when in an activated state
18524859 investigated the properties of four dRTA-associated AE1 mutations (R589H, G609R, S613F, and G701D) by heterologous expression in Xenopus laevis oocytes
18358003 The absence of the central beta-strand in cytosolic domain of kidney AE1 (kAE1) results in a less stable and more open structure than cytosolic domain of AE1.
18266205 coexistence of both homozygous or compound heterozygous SLC4A1 mutations and hemoglobinopathy has a combined effect on red cell morphology and degree of hemolytic anemia, which is aggravated by acidosis
18160114 these results suggest that host band 3 interacts with PfSPP during RBC invasion presumably following parasite microneme discharge.
17971901 AE1 plays a crucial role in the pathogenesis of gastric and colonic adenocarcinoma
17941824 Mutations in AE1 can cause Southeast Asian ovalocytosis or distal renal tubular acidosis.
17854772 These results suggest that oxidative stress renders the erythrocytes susceptible to clearance by macrophages through activation of caspases leading to band 3 aggregation.
17652430 Coexpression of carbonic anhydrase IX and SLC4A1 activated SLC4A1 mediated transport.
17554061 Point mutations of AE1 resulting in nonselective cation conductance were associated with hemolytic anemia
17553790 ILK may provide a linkage between kAE1 and the underlying actin cytoskeleton to stabilize kAE1 at the basolateral membrane, resulting in higher levels of cell surface expression
17533027 most of the patients with distal renal tubular acidosis studied carried autosomal recessive AE1 mutations
17453414 These results demonstrate that the studied residues in the AE1 C-terminus differently affect the expression, membrane trafficking and functional folding of AE1.
17408468 Observational study of gene-disease association. (HuGE Navigator)
17361021 Erythrocyte aggregation index is dependent of the phosphorylated/dephosphorylated state of band 3.
17317744 Although this conductive pathway is not a usual feature of intact mammalian AE1, it shares many properties with the anion-conductive pathways intrinsic to two other Cl-HCO3- exchangers, trout AE1 and mammalian SLC26A7.
17205967 Ihereted dRTA can be recessive or autosomal dominant: the autosomal form is invariable (and the recessive form occasionally) associated with mutations in the gene SLC4A1, which encodes for the membrane protein Anion Exchanger 1 (AE1).
17137217 Observational study of gene-disease association. (HuGE Navigator)
17128827 Observational study of gene-disease association. (HuGE Navigator)
17027918 When co-expressed, wild-type kAE1 could form heterodimer with kAE1 SAO or kAE1 G701D and could rescue mutant kAE1 proteins to express on the cell surface.
16960783 Observational study of gene-disease association. (HuGE Navigator)
16960783 AE1 promoter allele might influence the infection phenotype and the risk of fatal outcome in children with severe malaria.
16914912 Localization of band 3 mutation may be correlated with hereditary spherocytosis caused by band 3 deficiency.
16849697 Compound heterozygous (A858D/DeltaV850) patients likely possess a decreased amount of functional anion exchangers at the basolateral membrane of their alpha-intercalated cells
16762928 off rates of the band 3-ankyrin interaction are sufficiently slow to allow sustained erythrocyte deformation without loss of elasticity
16718373 The interactions of three protein 4.2-derived recombinant proteins with CDB3 and ankyrin were investigated by using Far-Western blot and pull-down assay.
16700540 This provides the first direct physical evidence for structural changes in hAE1 induced by substrates.
16420521 introduction of a polar mutation into a transmembrane segment resulted in Golgi retention of the recessive G701D mutant
16411779 results show that the hereditary spherocytosis mutant cdb3 proteins do not differ to any great extent in structure from the wild-type protein, suggesting that the HS mutations may directly affect protein 4.2 binding
16392641 Finds two Mexican patients with a specific 27-bp deletion in the solute carrier family 4 gene (SLC4A1delta27) (also known as the band 3 gene found on chromosome 17q21-q22), characteristic of Southeast Asian ovalocytosis (SAO).
16229454 data provide the first demonstration of a defined change in the molecular structure of cdAE1, and also indicate that the structure under physiological conditions is different from the crystal structure determined at low pH
16118313 identification of a novel band 3 mutant and its structural and functional characterization enabled us to identify pivotal roles for the 11 N-terminal amino acids in several protein functions and, in turn, in red-cell physiology
16107207 The effect of the SAO deletion on stability and trafficking of AE1 and kAE1 in transfected HEK-293 cells and kAE1 in MDCK epithelial cells is reported.
16013436 Decrease in the band 3 protein is associated with acute and chronic renal failure
15907563 A parasite-induced modification of band 3 promotes adhesion and induces antigenic changes in the P. falciparum-infected erythrocyte.
15847654 Observational study of genetic testing. (HuGE Navigator)
15813913 Missense mutation in a case of hereditary spherocytosis.
15811326 examination of interaction with tumor suppressor p16
15653731 E681OH AE1 has a second Cl- binding/transport site that is distinct from the Cl- transport site in the native protein
15500919 conformational change (in a region of the protein involved in the enhanced adhesiveness of Plasmodium falciparum-infected erythrocytes) induced by malaria infection
15478802 host membrane proteins such as AE1 contribute to the adhesion of malaria-infected erythrocytes to CD36
15310273 Quantitative analysis of erythrocyte membrane proteins revealed decrease in band 3 protein from patients with homozygous and heterozygous forms of beta-thalassemia.
15252044 an autosomal recessive distal renal tubular acidosis mutant (S773P) of the human kidney anion exchanger (kAE1) has trafficking defects
15211439 Two novel compound heterozygous SLC4A1 G701D/S773P and SAO/R602H mutations were identified in Thai patients with autosomal recessive distal renal tubular acidosis.
15182940 the binding of autologous IgG to band 3 dimers (AIgGB) is much greater with hypoxic erythrocytes from newborns as compared to that from adults
15121092 measured the distance between the C201 residues in adjacent dimerized cytoplasmic domains of AE1
15087282 The cdB3 interaction is strongly dependent on pH and the number of negative and positive charges of the peptide and at the effector binding site, respectively
15067510 Current research addressing this central question in the pathobiology of inherited dRTA associated with mutations in the SLC4A1 gene. Review.
15039022 old RBCs display higher Tyr-phosphorylation levels of band 3 than younger cells under hypertonic conditions, at least in part due to the reduced cell volume of old RBCs, a condition of lowered threshold for activation of volume-sensitive PTKs
14769040 Amino acid segment Asp893-Val911 at the hydrophilic carboxyl (C)-terminus of human erythrocyte membrane band 3 protein interacts with glycophorin A C-terminus Lys101-Asn130 and is able to cleave it at the Leu118-Ser119 bond.
14736961 Patients with familial autosomal dominant distal renal tubular acidosis associated with the SLC4A1 mutation.
14734552 dominant dRTA is associated with non-polarized trafficking of the protein, with no significant effect on anion transport function in vitro, which remains an unusual mechanism of human disease.
14695625 Neither mutation was associated with altered susceptibility to asymptomatic Plasmodium falciparum or P. vivax infection. Contribution of these erythrocyte polymorphisms to susceptibility to clinical malaria morbidity requires further study.
14654610 A novel mutation in the AE1 gene was identified in association with autosomal dominant distal renal tubular acidosis. We suggest that RTA be considered a diagnostic possibility in all children with failure to thrive and nephrocalcinosis.
14640982 Palmitoylation is not required for trafficking of anion exchanger 1 to the plasma membrane.
14604989 band 3 in the red cell can take up two different structures: one with high anion transport activity when glycophorin A is present and one with lower anion transport activity when glycophorin A is absent
14570914 Band 3 is cleaved by caspase 3 at the N-terminal cytoplasmic domain
12938018 Anion exchanger 1 mutations are associated with distal renal tubular acidosis
12933803 data increase the minimal extent of a functionally defined carbonic anhydrase 2 binding site in anion exchanger 1
12813056 human red cell anion exchanger transport function and surface trafficking is enhanced by glycophorin A
12578372 The first spectral and kinetic evidence is presented for the existence of an apparent high-affinity, chloride-binding, allosteric modifier site which functions to convert band 3 (AE1) from a symmetrical to an asymmetrical dimeric conformational state.
12482869 the NH(2) terminus of cdb3 is proximal to but not required for the cdb3-ankyrin interaction
12482865 role of the N-terminal region of the transmembrane domain
12466935 Functional alteration of band 3 is due to its oxidative modification originated as a consequence of the exposure to hypobaric hypoxia and further reoxygenation.
12446737 an examination of the topology in the c-terminal domain of this protein
12227829 mutant kAE1 proteins exhibited impaired trafficking from the endoplasmic reticulum to the plasma membrane as determined by immunolocalization, cell-surface biotinylation, oligosaccharide processing and pulse-chase experiments
12175337 Ca2+ promotes erythrocyte band 3 tyrosine phosphorylation via dissociation of phosphotyrosine phosphatase from band 3.
12149479 substrate-dependent reversal of anion transport site orientation in the human red blood cell anion-exchange protein, AE-1
12101015 Sulfate transport by band-3 protein in adult human erythrocytes was shown to be modulated by oxygen pressure.
12087557 G701D mutation of anion exchanger 1 gene causes autosomal recessive distal renal tubular acidosis.
12070037 Band 3 is an anchor protein for and a target for SHP-2 tyrosine phosphatase in human erythrocytes.
11994299 extracellular loop 4 binds carbonic anhydrase IV
11934690 R589H distal renal tubular acidosis(dRTA)mutation creates a severe trafficking defect in kAE1 but not in erythroid AE1 [kAE1]
11876646 clarification of sidedness of lysine 743 residue
11844997 REVIEW. Involvement in erythrocyte and kidney disorders.
11831035 function as anion exchanger

AA Sequence

MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKN      1 - 70
QELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFI     71 - 140
FEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEG    141 - 210
HSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQ    211 - 280
LGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS    281 - 350
PAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSPQVLAAVIFIYFAALSPA    351 - 420
ITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGR    421 - 490
VWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQKTYNYNVLMV    491 - 560
PKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYTQ    561 - 630
KLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGS    631 - 700
GFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLV    701 - 770
GLSILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQ    771 - 840
IICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRNVELQCLDADDAKATFDEEEGRDEYDEVAMP    841 - 910
V//

Text Mined References (262)

PMID Year Title
26823170 2016 Host-parasite interaction: multiple sites in the Plasmodium vivax tryptophan-rich antigen PvTRAg38 interact with the erythrocyte receptor band 3.
26542571 2015 Crystal structure of the anion exchanger domain of human erythrocyte band 3.
26049106 2015 Transmembrane protein 139 (TMEM139) interacts with human kidney isoform of anion exchanger 1 (kAE1).
26047685 2015 The evolutionary origins of Southeast Asian Ovalocytosis.
25957428 2015 A novel mutation pattern of kidney anion exchanger 1 gene in patients with distal renal tubular acidosis in Iran.
25628009 2015 The apicomplexan parasite Babesia divergens internalizes band 3, glycophorin A and spectrin during invasion of human red blood cells.
25616663 2015 Evidence of a structural and functional ammonium transporter RhBG·anion exchanger 1·ankyrin-G complex in kidney epithelial cells.
25388786 2015 Partial pyruvate kinase deficiency aggravates the phenotypic expression of band 3 deficiency in a family with hereditary spherocytosis.
25344524 2015 The cytoskeletal binding domain of band 3 is required for multiprotein complex formation and retention during erythropoiesis.
25257781 Differential roles of tryptophan residues in the functional expression of human anion exchanger 1 (AE1, Band 3, SLC4A1).
25012180 2015 Physical and functional links between anion exchanger-1 and sodium pump.
24964668 2014 A 65 bp deletion in band 3 gene of beta-thalassemia patients in Indonesia.
24920676 2014 Degradation mechanism of a Golgi-retained distal renal tubular acidosis mutant of the kidney anion exchanger 1 in renal cells.
24758720 2014 Automated structure refinement for a protein heterodimer complex using limited EPR spectroscopic data and a rigid-body docking algorithm: a three-dimensional model for an ankyrin-CDB3 complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24252324 2013 Molecular diagnosis of distal renal tubular acidosis in Tunisian patients: proposed algorithm for Northern Africa populations for the ATP6V1B1, ATP6V0A4 and SCL4A1 genes.
24121512 2013 A substrate access tunnel in the cytosolic domain is not an essential feature of the solute carrier 4 (SLC4) family of bicarbonate transporters.
23878048 2013 Acute kernicterus in a neonate with O/B blood group incompatibility and a mutation in SLC4A1.
23846695 2013 Structural model of the anion exchanger 1 (SLC4A1) and identification of transmembrane segments forming the transport site.
23842529 2013 Rapid Cl?/HCO??exchange kinetics of AE1 in HEK293 cells and hereditary stomatocytosis red blood cells.
23583773 2013 Three-dimensional model for the human Cl-/HCO3- exchanger, AE1, by homology to the E. coli ClC protein.
23460825 2013 Functional rescue of a kidney anion exchanger 1 trafficking mutant in renal epithelial cells.
23255290 2013 Hereditary spherocytosis due to band 3 deficiency: 15 novel mutations in SLC4A1.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23219802 2013 Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains.
23013433 2013 Oxygen regulates the band 3-ankyrin bridge in the human erythrocyte membrane.
22919024 2012 Tropical distal renal tubular acidosis: clinical and epidemiological studies in 78 patients.
22861190 2012 Identification of contact sites between ankyrin and band 3 in the human erythrocyte membrane.
22609520 2012 Identification of two novel mutations in the SLC4A1 gene in two unrelated Chinese families with distal renal tubular acidosis.
22580993 2012 A thiol-mediated active membrane transport of selenium by erythroid anion exchanger 1 protein.
22518001 2012 Mutation conferring apical-targeting motif on AE1 exchanger causes autosomal dominant distal RTA.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22426110 2012 The SLC4A1 gene is under differential selective pressure in primates infected by Plasmodium falciparum and related parasites.
22214711 2011 Evidence that the degree of band 3 phosphorylation modulates human erythrocytes nitric oxide efflux--in vitro model of hyperfibrinogenemia.
22170767 2012 A de novo band 3 mutation in hereditary spherocytosis.
22155194 2012 Arg 901 in the AE1 C-terminal tail is involved in conformational change but not in substrate binding.
22126643 2012 dRTA and hemolytic anemia: first detailed description of SLC4A1 A858D mutation in homozygous state.
21871436 2011 Human kidney anion exchanger 1 interacts with kinesin family member 3B (KIF3B).
21849667 2011 Loss-of-function and gain-of-function phenotypes of stomatocytosis mutant RhAG F65S.
21761435 2011 Mushroom-shaped red blood cells in protein band-3 deficiency.
21695904 2011 [Correlation of band 3 protein in erythrocytes with physiological status of middle-aged and elderly people].
21649639 2012 Anti-tumour effects of small interfering RNA targeting anion exchanger 1 in experimental gastric cancer.
21543742 2011 An intramolecular transport metabolon: fusion of carbonic anhydrase II to the COOH terminus of the Cl(-)/HCO(3)(-)exchanger, AE1.
21527529 2011 Critical band 3 multiprotein complex interactions establish early during human erythropoiesis.
21493712 2011 Determination of structural models of the complex between the cytoplasmic domain of erythrocyte band 3 and ankyrin-R repeats 13-24.
21455273 2011 Interactions of mouse glycophorin A with the dRTA-related mutant G719D of the mouse Cl-/HCO3- exchanger Ae1.
21300752 2011 Cytosolic H+ microdomain developed around AE1 during AE1-mediated Cl-/HCO3- exchange.
21269460 2011 Initial characterization of the human central proteome.
21257764 2011 Dual transport properties of anion exchanger 1: the same transmembrane segment is involved in anion exchange and in a cation leak.
21246053 2011 Irreversible AE1 tyrosine phosphorylation leads to membrane vesiculation in G6PD deficient red cells.
21209359 2011 Functional characterization and modified rescue of novel AE1 mutation R730C associated with overhydrated cation leak stomatocytosis.
21039340 2011 Protein 4.2 interaction with hereditary spherocytosis mutants of the cytoplasmic domain of human anion exchanger 1.
20960171 2010 A novel SLC4A1 variant in an autosomal dominant distal renal tubular acidosis family with a severe phenotype.
20932077 2010 Application of real-time PCR and melting curve analysis in rapid Diego blood group genotyping.
20833140 2010 Human kidney anion exchanger 1 interacts with adaptor-related protein complex 1 ?1A (AP-1 mu1A).
20828148 2010 Distance measurements within a concatamer of the plasma membrane Cl?/HCO?? exchanger, AE1.
20825599 2011 Distribution of Diego blood group alleles and identification of four novel mutations on exon 19 of SLC4A1 gene in the Chinese Han population by polymerase chain reaction sequence-based typing.
20799361 2010 Hemolytic anemia and distal renal tubular acidosis in two Indian patients homozygous for SLC4A1/AE1 mutation A858D.
20691413 2010 Genetic variation in solute carrier genes is associated with preeclampsia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20628050 2010 Cell surface rescue of kidney anion exchanger 1 mutants by disruption of chaperone interactions.
20576809 2010 Anion exchanger 1 interacts with nephrin in podocytes.
20561513 2010 Modifications of band 3 and oxidation level of membrane proteins in senescent erythrocytes.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20346715 2010 Band 3 multiprotein complexes in the red cell membrane; of mice and men.
20151848 2010 Impaired trafficking and intracellular retention of mutant kidney anion exchanger 1 proteins (G701D and A858D) associated with distal renal tubular acidosis.
20132789 2010 Mutation of His 834 in human anion exchanger 1 affects substrate binding.
20100494 2010 Structure of the membrane domain of human erythrocyte anion exchanger 1 revealed by electron crystallography.
20068363 2010 Distal renal tubular acidosis in Filipino children, caused by mutations of the anion-exchanger SLC4A1 (AE1, Band 3) gene.
20062076 2010 Induction of anion exchanger-1 translation and its opposite roles in the carcinogenesis of gastric cancer cells and differentiation of K562 cells.
20035734 2010 Rapid detection of solute carrier family 4, member 1 (SLC4A1) mutations and polymorphisms by high-resolution melting analysis.
20015879 2010 Cryohydrocytosis: increased activity of cation carriers in red cells from a patient with a band 3 mutation.
20007969 2010 Protein 4.2 binds to the carboxyl-terminal EF-hands of erythroid alpha-spectrin in a calcium- and calmodulin-dependent manner.
20005958 2010 Helical image reconstruction of the outward-open human erythrocyte band 3 membrane domain in tubular crystals.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19907019 2010 The GPA-dependent, spherostomatocytosis mutant AE1 E758K induces GPA-independent, endogenous cation transport in amphibian oocytes.
19846781 2009 Role of band 3 in regulating metabolic flux of red blood cells.
19722686 2009 Thiol-dependent membrane transport of selenium through an integral protein of the red blood cell membrane.
19625994 2009 Compound mutations in human anion exchanger 1 are associated with complete distal renal tubular acidosis and hereditary spherocytosis.
19564639 2009 Miltenberger blood group antigen type III (Mi.III) enhances the expression of band 3.
19438409 2009 Interaction of anion exchanger 1 and glycophorin A in human erythroleukaemic K562 cells.
19330352 2009 Expression of anion exchanger 1 is associated with tumor progress in human gastric cancer.
19294450 2009 Modulation of erythrocyte acetylcholinesterase activity and its association with G protein-band 3 interactions.
19289107 2009 Southeast Asian AE1 associated renal tubular acidosis: cation leak is a class effect.
19238475 2009 Derangement of erythrocytic AE1 in beta-thalassemia by caspase 3: pathogenic mechanisms and implications in red blood cell senescence.
19229254 2009 Molecular population genetics of SLC4A1 and Southeast Asian ovalocytosis.
19071041 Kinetic evidence for modulation by glycophorin A of a conformational equilibrium between two states of band 3 (SLC4A1) bound reversibly by the competitive inhibitor DIDS.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19029645 2008 Non-neuronal cholinergic system and signal transduction pathways mediated by band 3 in red blood cells.
18979639 2008 CrVI exposure and biomarkers: Cr in erythrocytes in relation to exposure and polymorphisms of genes encoding anion transport proteins.
18945214 2009 Oxidized and poorly glycosylated band 3 is selectively phosphorylated by Syk kinase to form large membrane clusters in normal and G6PD-deficient red blood cells.
18778682 2008 Effect of glycyrrhetinic acid on membrane band 3 in human erythrocytes.
18714043 2008 Chronic lymphocytic leukemia cells bind and present the erythrocyte protein band 3: possible role as initiators of autoimmune hemolytic anemia.
18524859 2008 Cation transport activity of anion exchanger 1 mutations found in inherited distal renal tubular acidosis.
18358003 2008 Structural characterization of the cytosolic domain of kidney chloride/bicarbonate anion exchanger 1 (kAE1).
18266205 2008 Hematological abnormalities in patients with distal renal tubular acidosis and hemoglobinopathies.
18160114 2008 A Presenilin-like protease associated with Plasmodium falciparum micronemes is involved in erythrocyte invasion.
17971901 2007 Expression of anion exchanger 1 sequestrates p16 in the cytoplasm in gastric and colonic adenocarcinoma.
17941824 2008 Dominant-negative effect of Southeast Asian ovalocytosis anion exchanger 1 in compound heterozygous distal renal tubular acidosis.
17854772 2007 Clearance of oxidized erythrocytes by macrophages: involvement of caspases in the generation of clearance signal at band 3 glycoprotein.
17652430 2007 Interactions of transmembrane carbonic anhydrase, CAIX, with bicarbonate transporters.
17554061 2007 Point mutations involved in red cell stomatocytosis convert the electroneutral anion exchanger 1 to a nonselective cation conductance.
17553790 2007 Interaction of integrin-linked kinase with the kidney chloride/bicarbonate exchanger, kAE1.
17533027 2007 Distal renal tubular acidosis associated with anion exchanger 1 mutations in children in Thailand.
17453414 Effect of block deletions in the C-terminus on the functional expression of human anion exchanger 1 (AE1).
17408468 2007 Genetic polymorphisms associated with priapism in sickle cell disease.
17361021 2007 Modulation of erythrocyte hemorheological properties by band 3 phosphorylation and dephosphorylation.
17317744 2007 A conductive pathway generated from fragments of the human red cell anion exchanger AE1.
17205967 2007 Immunohistochemical comparison of a case of inherited distal renal tubular acidosis (with a unique AE1 mutation) with an acquired case secondary to autoimmune disease.
17137217 2006 Association of sixty-one non-synonymous polymorphisms in forty-one hypertension candidate genes with blood pressure variation and hypertension.
17128827 [Polymorphism analysis of G199A, Ncol in ANK1 and Memphis I in SLC4A1 genes in Mexican healthy individuals and subjects affected with hereditary spherocytosis].
17027918 2006 Trafficking defect of mutant kidney anion exchanger 1 (kAE1) proteins associated with distal renal tubular acidosis and Southeast Asian ovalocytosis.
16960783 2006 Promoter polymorphism of the anion-exchange protein 1 associated with severe malarial anemia and fatality.
16914912 2006 Molecular and haematological studies of four families with hereditary spherocytosis resulting from band 3 deficiency.
16849697 2006 Expression and interaction of two compound heterozygous distal renal tubular acidosis mutants of kidney anion exchanger 1 in epithelial cells.
16762928 2006 Rate of rupture and reattachment of the band 3-ankyrin bridge on the human erythrocyte membrane.
16718373 2006 Associations of protein 4.2 with band 3 and ankyrin.
16700540 2006 Substrates induce conformational changes in human anion exchanger 1 (hAE1) as observed by fluorescence resonance energy transfer.
16669616 2006 Phosphatidylinositol-4,5-biphosphate (PIP2) differentially regulates the interaction of human erythrocyte protein 4.1 (4.1R) with membrane proteins.
16420521 2006 Dominant and recessive distal renal tubular acidosis mutations of kidney anion exchanger 1 induce distinct trafficking defects in MDCK cells.
16411779 2006 Structure and stability of hereditary spherocytosis mutants of the cytosolic domain of the erythrocyte anion exchanger 1 protein.
16392641 2005 Molecular demonstration of SLC4A1 gene deletion in two Mexican patients with Southeast Asian ovalocytosis.
16252102 2006 Recessive distal renal tubular acidosis in Sarawak caused by AE1 mutations.
16229454 2005 Conformational changes in the cytoplasmic domain of human anion exchanger 1 revealed by luminescence resonance energy transfer.
16227998 2005 Monovalent cation leaks in human red cells caused by single amino-acid substitutions in the transport domain of the band 3 chloride-bicarbonate exchanger, AE1.
16118313 2005 The N-terminal 11 amino acids of human erythrocyte band 3 are critical for aldolase binding and protein phosphorylation: implications for band 3 function.
16107207 2005 Trafficking defects of the Southeast Asian ovalocytosis deletion mutant of anion exchanger 1 membrane proteins.
16013436 2005 Alterations in band 3 protein and anion exchange in red blood cells of renal failure patients.
15907563 2005 Band 3 clustering promotes the exposure of neoantigens in Plasmodium falciparum-infected erythrocytes.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
15813913 2005 Band 3Tambaú: a de novo mutation in the AE1 gene associated with hereditary spherocytosis. Implications for anion exchange and insertion into the red blood cell membrane.
15811326 2005 Direct interaction and cooperative role of tumor suppressor p16 with band 3 (AE1).
15653731 2005 Evidence for a second binding/transport site for chloride in erythrocyte anion transporter AE1 modified at glutamate 681.
15500919 2004 Malaria infection induces a conformational change in erythrocyte band 3 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15478802 2004 Chemical modifications of band 3 protein affect the adhesion of Plasmodium falciparum-infected erythrocytes to CD36.
15310273 2004 Analysis of erythrocyte and platelet membrane proteins in various forms of beta-thalassemia.
15252044 2004 Trafficking defects of a novel autosomal recessive distal renal tubular acidosis mutant (S773P) of the human kidney anion exchanger (kAE1).
15211439 2004 Novel compound heterozygous SLC4A1 mutations in Thai patients with autosomal recessive distal renal tubular acidosis.
15182940 2004 Iron release, superoxide production and binding of autologous IgG to band 3 dimers in newborn and adult erythrocytes exposed to hypoxia and hypoxia-reoxygenation.
15121092 Use of luminescence resonance energy transfer to measure distances in the AE1 anion exchange protein dimer.
15087282 2004 Modulation of red cell glycolysis: interactions between vertebrate hemoglobins and cytoplasmic domains of band 3 red cell membrane proteins.
15067510 2004 Defects in processing and trafficking of the AE1 Cl-/HCO3- exchanger associated with inherited distal renal tubular acidosis.
15039022 2004 Phosphotyrosine phosphatases acting on band 3 in human erythrocytes of different age: PTP1B processing during cell ageing.
14769040 2004 Purification and characterization of the human erythrocyte band 3 protein C-terminal domain.
14736961 2004 Characterization of a highly polymorphic marker adjacent to the SLC4A1 gene and of kidney immunostaining in a family with distal renal tubular acidosis.
14734552 2004 A novel missense mutation in AE1 causing autosomal dominant distal renal tubular acidosis retains normal transport function but is mistargeted in polarized epithelial cells.
14695625 2004 Glycophorin C (Gerbich antigen blood group) and band 3 polymorphisms in two malaria holoendemic regions of Papua New Guinea.
14654610 2003 A novel mutation in the anion exchanger 1 gene is associated with familial distal renal tubular acidosis and nephrocalcinosis.
14640982 2004 Palmitoylation is not required for trafficking of human anion exchanger 1 to the cell surface.
14604989 2004 Altered structure and anion transport properties of band 3 (AE1, SLC4A1) in human red cells lacking glycophorin A.
14570914 2003 Caspase 3-mediated proteolysis of the N-terminal cytoplasmic domain of the human erythroid anion exchanger 1 (band 3).
12938018 2003 Anion exchanger 1 mutations associated with distal renal tubular acidosis in the Thai population.
12933803 2003 Deficient HCO3- transport in an AE1 mutant with normal Cl- transport can be rescued by carbonic anhydrase II presented on an adjacent AE1 protomer.
12813056 2003 Distinct regions of human glycophorin A enhance human red cell anion exchanger (band 3; AE1) transport function and surface trafficking.
12578372 2003 The carboxyl side chain of glutamate 681 interacts with a chloride binding modifier site that allosterically modulates the dimeric conformational state of band 3 (AE1). Implications for the mechanism of anion/proton cotransport.
12539048 2003 Non-polarized targeting of AE1 causes autosomal dominant distal renal tubular acidosis.
12531814 2003 A band 3-based macrocomplex of integral and peripheral proteins in the RBC membrane.
12482869 2003 Identification of a critical ankyrin-binding loop on the cytoplasmic domain of erythrocyte membrane band 3 by crystal structure analysis and site-directed mutagenesis.
12482865 2003 The N-terminal region of the transmembrane domain of human erythrocyte band 3. Residues critical for membrane insertion and transport activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466935 2002 Hypobaric hypoxia-reoxygenation diminishes band 3 protein functions in human erythrocytes.
12446737 2003 Novel topology in C-terminal region of the human plasma membrane anion exchanger, AE1.
12227829 2002 Impaired trafficking of human kidney anion exchanger (kAE1) caused by hetero-oligomer formation with a truncated mutant associated with distal renal tubular acidosis.
12175337 2002 Ca2+ promotes erythrocyte band 3 tyrosine phosphorylation via dissociation of phosphotyrosine phosphatase from band 3.
12149479 2002 Substrate-dependent reversal of anion transport site orientation in the human red blood cell anion-exchange protein, AE1.
12101015 2002 Band-3 protein function in human erythrocytes: effect of oxygenation-deoxygenation.
12070037 2002 Band 3 is an anchor protein and a target for SHP-2 tyrosine phosphatase in human erythrocytes.
11994299 2002 The extracellular component of a transport metabolon. Extracellular loop 4 of the human AE1 Cl-/HCO3- exchanger binds carbonic anhydrase IV.
11934690 2002 Impaired trafficking of distal renal tubular acidosis mutants of the human kidney anion exchanger kAE1.
11842009 2002 Identification of an apical Cl(-)/HCO3(-) exchanger in the small intestine.
11831035 2001 [Band 3: expanding knowledge on its functions].
11756190 2002 Band 3 Walton, a C-terminal deletion associated with distal renal tubular acidosis, is expressed in the red cell membrane but retained internally in kidney cells.
11380459 2001 Band 3 Cape Town (E90K) causes severe hereditary spherocytosis in combination with band 3 Prague III.
11208611 2001 Pendrin: an apical Cl-/OH-/HCO3- exchanger in the kidney cortex.
11208088 2000 Trafficking and folding defects in hereditary spherocytosis mutants of the human red cell anion exchanger.
11155072 2000 Distinctive Swann blood group genotypes: molecular investigations.
11063570 2000 Localization of the Cl-/HCO3- anion exchanger binding site to the amino-terminal region of carbonic anhydrase II.
11061863 2000 An amino acid substitution in the putative second extracellular loop of RBC band 3 accounts for the Froese blood group polymorphism.
11049968 2000 Crystallographic structure and functional interpretation of the cytoplasmic domain of erythrocyte membrane band 3.
10950304 2000 Adducin: structure, function and regulation.
10942416 2000 Severe hereditary spherocytosis and distal renal tubular acidosis associated with the total absence of band 3.
10942405 2000 Sequential phosphorylation of protein band 3 by Syk and Lyn tyrosine kinases in intact human erythrocytes: identification of primary and secondary phosphorylation sites.
10926824 2000 Band 3 mutations, renal tubular acidosis and South-East Asian ovalocytosis in Malaysia and Papua New Guinea: loss of up to 95% band 3 transport in red cells.
10861210 2000 Processing of N-linked oligosaccharide depends on its location in the anion exchanger, AE1, membrane glycoprotein.
10820026 2000 Identification of the carbonic anhydrase II binding site in the Cl(-)/HCO(3)(-) anion exchanger AE1.
10745622 2000 Characteristic features of the genotype and phenotype of hereditary spherocytosis in the Japanese population.
10738034 2000 Amino acid substitutions in human erythroid protein band 3 account for the low-incidence antigens NFLD and BOW.
10580570 1999 Arginine 490 is a hot spot for mutation in the band 3 gene in hereditary spherocytosis.
10364201 1999 Calnexin interaction with N-glycosylation mutants of a polytopic membrane glycoprotein, the human erythrocyte anion exchanger 1 (band 3).
9973643 1998 Band 3 Tokyo: Thr837-->Ala837 substitution in erythrocyte band 3 protein associated with spherocytic hemolysis.
9854053 1998 Novel AE1 mutations in recessive distal renal tubular acidosis. Loss-of-function is rescued by glycophorin A.
9845551 1998 Characterization of seven low incidence blood group antigens carried by erythrocyte band 3 protein.
9774471 1998 Carbonic anhydrase II binds to the carboxyl terminus of human band 3, the erythrocyte C1-/HCO3- exchanger.
9765907 1998 Studies on the structure of a transmembrane region and a cytoplasmic loop of the human red cell anion exchanger (band 3, AE1).
9734643 1998 Homozygous missense mutation (band 3 Fukuoka: G130R): a mild form of hereditary spherocytosis with near-normal band 3 content and minimal changes of membrane ultrastructure despite moderate protein 4.2 deficiency.
9709782 1998 A Gly565-->Ala substitution in human erythroid band 3 accounts for the Wu blood group polymorphism.
9709005 1998 NMR solution structure of a cytoplasmic surface loop of the human red cell anion transporter, band 3.
9600966 1998 Mutations in the chloride-bicarbonate exchanger gene AE1 cause autosomal dominant but not autosomal recessive distal renal tubular acidosis.
9454576 1998 Insights into tyrosine phosphorylation control of protein-protein association from the NMR structure of a band 3 peptide inhibitor bound to glyceraldehyde-3-phosphate dehydrogenase.
9422766 1998 Kanadaptin is a protein that interacts with the kidney but not the erythroid form of band 3.
9312167 1997 Familial distal renal tubular acidosis is associated with mutations in the red cell anion exchanger (Band 3, AE1) gene.
9233560 1997 Heterogenous band 3 deficiency in hereditary spherocytosis related to different band 3 gene defects.
9207478 1997 Modulation of clinical expression and band 3 deficiency in hereditary spherocytosis.
9191821 1997 Blood group antigens Rb(a), Tr(a), and Wd(a) are located in the third ectoplasmic loop of erythroid band 3.
9012689 1997 Novel band 3 variants (bands 3 Foggia, Napoli I and Napoli II) associated with hereditary spherocytosis and band 3 deficiency: status of the D38A polymorphism within the EPB3 locus.
8960772 1996 Human erythroid band 3 "anion exchanger 1" is expressed in transformed lymphocytes.
8943874 1996 Characterization of 13 novel band 3 gene defects in hereditary spherocytosis with band 3 deficiency.
8841202 1996 Targeted disruption of the murine erythroid band 3 gene results in spherocytosis and severe haemolytic anaemia despite a normal membrane skeleton.
8808627 1996 Anion exchanger 1 (band 3) is required to prevent erythrocyte membrane surface loss but not to form the membrane skeleton.
8704215 1996 Hereditary spherocytosis with band 3 deficiency. Association with a nonsense mutation of the band 3 gene (allele Lyon), and aggravation by a low-expression allele occurring in trans (allele Genas).
8693505 1996 Assignment of the gene(s) governing Froese and Swann blood group polymorphism to chromosome 17q.
8640229 1996 Ankyrin-1 mutations are a major cause of dominant and recessive hereditary spherocytosis.
8578746 1995 Blood group terminology 1995. ISBT Working Party on terminology for red cell surface antigens.
8567957 1996 A nonsense mutation in the erythrocyte band 3 gene associated with decreased mRNA accumulation in a kindred with dominant hereditary spherocytosis.
8547122 1995 Band 3 Chur: a variant associated with band 3-deficient hereditary spherocytosis and substitution in a highly conserved position of transmembrane segment 11.
8527430 1995 Solution structure of a band 3 peptide inhibitor bound to aldolase: a proposed mechanism for regulating binding by tyrosine phosphorylation.
8508760 1993 Two-dimensional structure of the membrane domain of human band 3, the anion transport protein of the erythrocyte membrane.
8471774 1993 Human erythrocyte protein 4.2 deficiency associated with hemolytic anemia and a homozygous 40glutamic acid-->lysine substitution in the cytoplasmic domain of band 3 (band 3Montefiore).
8434259 1993 Molecular and cellular biology of the erythrocyte anion exchanger (AE1).
8343110 1993 Band 3 HT, a human red-cell variant associated with acanthocytosis and increased anion transport, carries the mutation Pro-868-->Leu in the membrane domain of band 3.
8282779 1994 Duplication of 10 nucleotides in the erythroid band 3 (AE1) gene in a kindred with hereditary spherocytosis and band 3 protein deficiency (band 3PRAGUE).
8206915 1994 Band 3 Memphis variant II. Altered stilbene disulfonate binding and the Diego (Dia) blood group antigen are associated with the human erythrocyte band 3 mutation Pro854-->Leu.
8168533 1994 The solution structures of the first and second transmembrane-spanning segments of band 3.
8045253 1994 Three-dimensional map of the dimeric membrane domain of the human erythrocyte anion exchanger, Band 3.
7949112 1994 The homozygous state for the band 3 protein mutation in Southeast Asian Ovalocytosis may be lethal.
7919393 1994 Southeast Asian ovalocytosis in an African-American family.
7902326 1993 The Diego blood group locus is located on chromosome 17q.
7812009 1995 Changes in the blood group Wright antigens are associated with a mutation at amino acid 658 in human erythrocyte band 3: a site of interaction between band 3 and glycophorin A under certain conditions.
7774942 1995 Assignment of the Waldner blood group locus (WD) to 17q12-q21.
7665627 1995 The ANK repeats of erythrocyte ankyrin form two distinct but cooperative binding sites for the erythrocyte anion exchanger.
7530501 1995 Mutations of conserved arginines in the membrane domain of erythroid band 3 lead to a decrease in membrane-associated band 3 and to the phenotype of hereditary spherocytosis.
7506871 1993 Anion exchanger 1 in human kidney and oncocytoma differs from erythroid AE1 in its NH2 terminus.
7479704 1995 Crystallization and preliminary X-ray analysis of the cytoplasmic domain of human erythrocyte band 3.
6615451 1983 The human erythrocyte anion-transport protein. Partial amino acid sequence, conformation and a possible molecular mechanism for anion exchange.
6449514 1980 Reassociation of ankyrin with band 3 in erythrocyte membranes and in lipid vesicles.
6345535 1983 Amino acid sequence of the N alpha-terminal 201 residues of human erythrocyte membrane band 3.
4027230 1985 A new variant of the anion transport protein in human erythrocytes.
3478298 1987 Localization of the gene for the erythroid anion exchange protein, band 3 (EMPB3), to human chromosome 17.
3372523 1988 Localization of the pyridoxal phosphate binding site at the COOH-terminal region of erythrocyte band 3 protein.
3223947 1988 The complete amino acid sequence of the human erythrocyte membrane anion-transport protein deduced from the cDNA sequence.
2968981 1988 Associations of human erythrocyte band 4.2. Binding to ankyrin and to the cytoplasmic domain of band 3.
2790053 1989 Primary structure of the cytoplasmic domain of human erythrocyte protein band 3. Comparison with its sequence in the mouse.
2594752 1989 Cloning and characterization of band 3, the human erythrocyte anion-exchange protein (AE1).
2575590 1989 A PstI polymorphism for the human erythrocyte surface protein band 3 (EPB3) demonstrates close linkage of EPB3 to the nerve growth factor receptor.
2065070 1991 Three regions of erythrocyte band 3 protein are phosphorylated on tyrosines: characterization of the phosphorylation sites by solid phase sequencing combined with capillary electrophoresis.
1998697 1991 Phosphorylation sites in human erythrocyte band 3 protein.
1885574 1991 Palmitoylation of cysteine 69 from the COOH-terminal of band 3 protein in the human erythrocyte membrane. Acylation occurs in the middle of the consensus sequence of F--I-IICLAVL found in band 3 protein and G2 protein of Rift Valley fever virus.
1824272 1991 Melanesian hereditary ovalocytes have a deletion in red cell band 3.
1737855 1992 Molecular basis for membrane rigidity of hereditary ovalocytosis. A novel mechanism involving the cytoplasmic domain of band 3.
1722314 1991 Deletion in erythrocyte band 3 gene in malaria-resistant Southeast Asian ovalocytosis.
1678289 1991 Human erythrocyte band 3 polymorphism (band 3 Memphis): characterization of the structural modification (Lys 56----Glu) by protein chemistry methods.
1639060 1992 Identification of the binding interface involved in linkage of cytoskeletal protein 4.1 to the erythrocyte anion exchanger.
1538405 1992 Basis of unique red cell membrane properties in hereditary ovalocytosis.
1527044 1992 A structural study of the membrane domain of band 3 by tryptic digestion. Conformational change of band 3 in situ induced by alkali treatment.
1520883 1992 Band 3 Memphis: a widespread polymorphism with abnormal electrophoretic mobility of erythrocyte band 3 protein caused by substitution AAG----GAG (Lys----Glu) in codon 56.
1471983 1992 A red cell band 3 variant with altered stilbene disulphonate binding is associated with the Diego (Dia) blood group antigen.
1378323 1992 Band 3 Tuscaloosa: Pro327----Arg327 substitution in the cytoplasmic domain of erythrocyte band 3 protein associated with spherocytic hemolytic anemia and partial deficiency of protein 4.2.
1352774 1992 Anion-proton cotransport through the human red blood cell band 3 protein. Role of glutamate 681.
701248 1978 Orientation of the band 3 polypeptide from human erythrocyte membranes. Identification of NH2-terminal sequence and site of carbohydrate attachment.
695442 1978 A 'new' blood group antigen Fra: incidence, inheritance and genetic linkage analysis.
379653 1979 The membrane attachment protein for spectrin is associated with band 3 in human erythrocyte membranes.