Property Summary

NCBI Gene PubMed Count 18
PubMed Score 41.76
PubTator Score 32.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 3.600 4.4e-09
adult high grade glioma 1.200 1.7e-02
psoriasis 1.300 2.4e-25
facioscapulohumeral dystrophy 1.500 2.5e-02

Gene RIF (11)

PMID Text
24985703 These were associated with markedly reduced or increased MATE2-K function.
23630107 The results confirmed that OAT1, OAT3, OCT2, MATE1, and MATE2-K were coexpressed in tubular epithelial cells.
23267855 The effect of novel promoter variants in ... MATE2 on the pharmacokinetics and pharmacodynamics of metformin
22558177 MATE2, which facilitates extrusion of drugs and metabolites from blood into urine, is physically or functionally associated with cilia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20067714 characterization of MATE2-K: kinetic analysis of transport of cimetidine and tetraethylammonium; inhibitors; comparison to hMATE1 and rMATE1
20047987 4',6-diamidino-2-phenylindole (DAPI) can be used as a probe substrate for rapid assays of the functionality of the human MATE2
20016398 The purpose of this study was to evaluate the effects of heterozygous MATE variants on the disposition of metformin in mice and humans.
20016398 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19158817 These findings suggested that the loss of transport activities of the MATE1 G64D and MATE2-K G211V variants were due to the alteration of protein expression in cell surface membranes.
17509534 hMATE1 and hMATE2-K function together as a detoxication system, by mediating the tubular secretion of intracellular ionic compounds across the brush-border membranes of the kidney.

AA Sequence

MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCGHLGKVELASV      1 - 70
TLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLLLCCLPCWALFLNTQHILLLF     71 - 140
RQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWLKGQEEESPFQTPGLSILHPSHSHLSRASFH    141 - 210
LFQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGW    211 - 280
SSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCV    281 - 350
RVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVF    351 - 420
EAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTA    421 - 490
RLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAH    491 - 560
ALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILATRH                                561 - 602
//

Text Mined References (20)

PMID Year Title
24985703 2014 Identification and functional characterization of novel nonsynonymous variants in the human multidrug and toxin extrusion 2-K.
23630107 2013 Precise comparison of protein localization among OCT, OAT, and MATE in human kidney.
23267855 2013 The effect of novel promoter variants in MATE1 and MATE2 on the pharmacokinetics and pharmacodynamics of metformin.
22558177 2012 Exploring the transcriptome of ciliated cells using in silico dissection of human tissues.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20067714 2009 Functional characteristics of two human MATE transporters: kinetics of cimetidine transport and profiles of inhibition by various compounds.
20047987 2010 Evaluation of 4',6-diamidino-2-phenylindole as a fluorescent probe substrate for rapid assays of the functionality of human multidrug and toxin extrusion proteins.
20016398 2010 Heterozygous variants of multidrug and toxin extrusions (MATE1 and MATE2-K) have little influence on the disposition of metformin in diabetic patients.
19158817 2009 Identification of multidrug and toxin extrusion (MATE1 and MATE2-K) variants with complete loss of transport activity.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17509534 2007 Substrate specificity of MATE1 and MATE2-K, human multidrug and toxin extrusions/H(+)-organic cation antiporters.
16996621 2006 The MATE proteins as fundamental transporters of metabolic and xenobiotic organic cations.
16807400 2006 Identification and functional characterization of a new human kidney-specific H+/organic cation antiporter, kidney-specific multidrug and toxin extrusion 2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16330770 2005 A human transporter protein that mediates the final excretion step for toxic organic cations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.