Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.85
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (10)

Disease log2 FC p
urothelial carcinoma -3.200 8.4e-20
osteosarcoma -1.774 1.5e-06
Atopic dermatitis -2.200 2.4e-05
tuberculosis 2.800 1.5e-06
non-small cell lung cancer -2.731 4.6e-27
interstitial cystitis -3.200 5.4e-06
psoriasis -2.000 5.0e-48
lung adenocarcinoma -1.600 9.5e-09
Endometriosis -1.165 2.4e-02
lung carcinoma -1.200 6.2e-17

Gene RIF (1)

PMID Text
18392855 Affected sib-pairs with cervical cancer susceptibility and high mean age at diagnosis show increased sharing at all microsatellite markers at 9q31.1-33.1 and linkage signals of up to maximum lod-score of 2.74 for TSCOT single nucleotide polymorphisms.

AA Sequence

MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQ      1 - 70
QRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGAA     71 - 140
ALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTA    141 - 210
CSVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHK    211 - 280
TTIALLFVGAIIYDLAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTM    281 - 350
IMIGMVSFGSGALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGV    351 - 420
VTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPISIVAYKQVPLSPYGDIIEK                   421 - 475
//

Text Mined References (10)

PMID Year Title
18392855 2008 Polymorphisms in 9q32 and TSCOT are linked to cervical cancer in affected sib-pairs with high mean age at diagnosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12826694 A putative 12-transmembrane domain cotransporter associated with apical membranes of the epididymal duct.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10978518 2000 Characterization of the mouse gene, human promoter and human cDNA of TSCOT reveals strong interspecies homology.
10706709 2000 A putative 12 transmembrane domain cotransporter expressed in thymic cortical epithelial cells.