Property Summary

NCBI Gene PubMed Count 23
PubMed Score 35.94
PubTator Score 32.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
pituitary cancer 1972 1.2e-07
osteosarcoma 7950 2.0e-05
pancreatic cancer 2398 7.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 1.3

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.178 2.0e-05
pancreatic cancer 1.200 7.0e-05
pituitary cancer -1.600 1.2e-07

Gene RIF (15)

AA Sequence

MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIGPVLGLVCVPL      1 - 70
LGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPLELALLILGVGLLDFCGQVCF     71 - 140
TPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPAIDWDTSALAPYLGTQEECLFGLLTLIFLTC    141 - 210
VAATLLVAEEAALGPTEPAEGLSAPSLSPHCCPCRARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELC    211 - 280
SWMALMTFTLFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFG    281 - 350
TRAVYLASVAAFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDTGG    351 - 420
ASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEARVVPGRGICL    421 - 490
DLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQVVFDKSDLAKYSA           491 - 553
//

Text Mined References (24)

PMID Year Title