Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.74
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma 3.195 1.3e-03
type II diabetes mellitus and post-ische... 1.400 1.1e-02
atypical teratoid / rhabdoid tumor -1.700 3.6e-02
glioblastoma 1.100 3.2e-03
adrenocortical carcinoma 2.091 1.1e-02
non-small cell lung cancer 1.463 7.1e-10
interstitial cystitis -1.900 8.2e-04
cystic fibrosis -3.100 1.1e-04
lung adenocarcinoma 1.100 1.8e-04
pediatric high grade glioma 1.100 1.4e-03
pilocytic astrocytoma 1.500 4.3e-03
posterior fossa group A ependymoma 1.100 1.3e-02
psoriasis 3.100 7.7e-07
ductal carcinoma in situ 2.200 4.5e-02

Synonym

Accession Q8NCS7 B5MCU3 Q4G0K0 Q8NA44 Q8NB86
Symbols CTL5

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (8)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNDTEKPADTPSEEEDFGDPRTYDPDFKGPVANRSCTDVLCCMIFLLCIIGYIVLGLVAWVHGDPRRAAY      1 - 70
PTDSQGHFCGQKGTPNENKTILFYFNLLRCTSPSVLLNLQCPTTQICVSKCPEKFLTYVEMQLLYTKDKS     71 - 140
YWEDYRQFCKTTAKPVKSLTQLLLDDDCPTAIFPSKPFLQRCFPDFSTKNGTLTIGSKMMFQDGNGGTRS    141 - 210
VVELGIAANGINKLLDAKSLGLKVFEDYARTWYWILIGLTIAMVLSWIFLILLRFIAGCLFWVFMIGVIG    211 - 280
IIGYGIWHCYQQYTNLQERPSSVLTIYDIGIQTNISMYFELQQTWFTFMIILCIIEVIVILMLIFLRNRI    281 - 350
RVAIILLKEGSKAIGYVPSTLVYPALTFILLSICICYWVVTAVFLATSGVPVYKVIAPGGHCIHENQTCD    351 - 420
PEIFNTTEIAKACPGALCNFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVIALGQCALAGAFATYYWAM    421 - 490
KKPDDIPRYPLFTAFGRAIRYHTGSLAFGSLIIALIQMFKIVLEYLDHRLKRTQNTLSKFLQCCLRCCFW    491 - 560
CLENAIKFLNRNAYIMIAIYGRNFCRSAKDAFNLLMRNVLKVAVTDEVTYFVLFLGKLLVAGSIGVLAFL    561 - 630
FFTQRLPVIAQGPASLNYYWVPLLTVIFGSYLIAHGFFSVYAMCVETIFICFLEDLERNDGSTARPYFVT    631 - 700
PNLHGILIKKQLVPQKQKE                                                       701 - 719
//

Text Mined References (9)

PMID Year Title
22864933 2012 Identification of novel germline polymorphisms governing capecitabine sensitivity.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15715662 2005 Molecular characterization of the family of choline transporter-like proteins and their splice variants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.