Property Summary

NCBI Gene PubMed Count 26
PubMed Score 37.97
PubTator Score 16.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Barrett's esophagus 2.600 4.0e-02
esophageal adenocarcinoma 3.300 1.8e-02
medulloblastoma, large-cell 1.100 2.8e-04
colon cancer -1.700 1.6e-02
pancreatic cancer 2.400 6.4e-06
interstitial cystitis -1.600 1.2e-02
nasopharyngeal carcinoma -2.100 4.6e-09
lung adenocarcinoma 1.409 2.4e-03
breast carcinoma 1.900 2.2e-20
Breast cancer 1.600 2.6e-04
ductal carcinoma in situ 3.000 4.2e-03
invasive ductal carcinoma 3.800 5.9e-05
ovarian cancer 2.000 5.8e-08

Gene RIF (9)

PMID Text
26901654 epigenetic mechanisms (histone modifications) play a role in determining the tissue-specific pattern of expression of the TPPT along the GI tract.
26828122 The results also provide an indirect support for a membrane topology for hTPPT with 10 transmembrane domains as predicted by the TMHMM transmembrane helixes prediction program.
25715703 Characterization of the SLC44A4 promoter and report the importance of both ELF3 and CREB-1 transcription factors in the maintenance of basal promoter activity in colonic epithelial cells.
24379411 Molecular identification and functional characterization of the human colonic thiamine pyrophosphate transporter.
23651124 These results indicate that CTL4 mediates ACh synthesis in non-neuronal cell lines and presents a mechanism to target non-neuronal ACh synthesis without affecting neuronal ACh synthesis.
22789125 These results suggest that eltrombopag can partially modulate some immune responses by TGFbeta(1) and sCTLA-4, but it does not induce immune tolerance by 24 weeks after treatment.
20526339 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20466734 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGGKQRDEDDEAYGKPVKYDPSFRGPIKNRSCTDVICCVLFLLFILGYIVVGIVAWLYGDPRQVLYPRNS      1 - 70
TGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVF     71 - 140
YTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLID    141 - 210
SLNARDISVKIFEDFAQSWYWILVALGVALVLSLLFILLLRLVAGPLVLVLILGVLGVLAYGIYYCWEEY    211 - 280
RVLRDKGASISQLGFTTNLSAYQSVQETWLAALIVLAVLEAILLLMLIFLRQRIRIAIALLKEASKAVGQ    281 - 350
MMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCEKVPINTSCNPTAHLVNSSCP    351 - 420
GLMCVFQGYSSKGLIQRSVFNLQIYGVLGLFWTLNWVLALGQCVLAGAFASFYWAFHKPQDIPTFPLISA    421 - 490
FIRTLRYHTGSLAFGALILTLVQIARVILEYIDHKLRGVQNPVARCIMCCFKCCLWCLEKFIKFLNRNAY    491 - 560
IMIAIYGKNFCVSAKNAFMLLMRNIVRVVVLDKVTDLLLFFGKLLVVGGVGVLSFFFFSGRIPGLGKDFK    561 - 630
SPHLNYYWLPIMTSILGAYVIASGFFSVFGMCVDTLFLCFLEDLERNNGSLDRPYYMSKSLLKILGKKNE    631 - 700
APPDNKKRKK                                                                701 - 710
//

Text Mined References (28)

PMID Year Title
26901654 2016 Mechanism(S) Involved in the Colon-Specific Expression of the Thiamine Pyrophosphate (Tpp) Transporter.
26828122 2016 The human colonic thiamine pyrophosphate transporter (hTPPT) is a glycoprotein and N-linked glycosylation is important for its function.
25715703 2015 Regulation of basal promoter activity of the human thiamine pyrophosphate transporter SLC44A4 in human intestinal epithelial cells.
24837172 2015 Genome-wide association scan in north Indians reveals three novel HLA-independent risk loci for ulcerative colitis.
24379411 2014 Molecular identification and functional characterization of the human colonic thiamine pyrophosphate transporter.
23651124 2013 Choline transporter-like protein 4 (CTL4) links to non-neuronal acetylcholine synthesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22789125 2012 TGF?(1) and sCTLA-4 levels are increased in eltrombopag-exposed patients with ITP.
20526339 2010 Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.
20466734 2010 Refining the association of MHC with multiple sclerosis in African Americans.
20421499 2010 Genome-wide association identifies OBFC1 as a locus involved in human leukocyte telomere biology.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15715662 2005 Molecular characterization of the family of choline transporter-like proteins and their splice variants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12067718 2002 Identification of a CTL4/Neu1 fusion transcript in a sialidosis patient.
10677542 2000 An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.