Property Summary

NCBI Gene PubMed Count 35
PubMed Score 38.40
PubTator Score 39.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.100 2.0e-02
ependymoma 1.200 9.6e-03
oligodendroglioma 1.300 1.5e-03
osteosarcoma -2.144 1.2e-03
glioblastoma 1.100 3.5e-03
medulloblastoma, large-cell -1.900 1.8e-03
non-small cell lung cancer -1.041 1.2e-16
intraductal papillary-mucinous adenoma (... 1.700 2.0e-04
intraductal papillary-mucinous carcinoma... 1.400 3.3e-03
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-03
pilocytic astrocytoma 1.300 2.6e-09
lung carcinoma -1.100 3.8e-17
ovarian cancer 1.500 1.1e-04

Protein-protein Interaction (1)

Gene RIF (18)

PMID Text
26601765 The differential expression pattern of CTL1 and CTL2 suggests that CTL1 is the key transporter involved in choline transport from maternal circulation and both transporters are likely involved in stromal and endothelial cell choline transport.
26593331 The Yi population of China had the highest frequency of blood donors at risk of harboring anti-HNA-3a compared to any population
26437811 Study found 38 SNPs, including one novel SNP, in 8192 nucleotides covering the CDS of the SLC44A2 gene among 302 blood donors.
25772935 Meta-analysis of 65,734 individuals identifies TSPAN15 and SLC44A2 as two susceptibility loci for venous thromboembolism.
25608003 The HNA-3 incompatibility in central Thais (33.28%) was higher than northern Thais (28.75%), corresponding to a significantly higher probability of HNA-3a alloimmunization (P<0.05) similar to Japanese and Chinese populations. This study showed the high risk of HNA-3 incompatibility and alloimmunization, especially in central Thai blood donors.
25006121 HNA-3a (CTL2) antibodies in the pathogenesis of transfusion-related acute lung injury
24846273 The findings show that, for binding to CTL2, Type 2 HNA-3a antibodies require nonpolymorphic amino acid residues in the third, and possibly the second, EC loops of CTL2
23398146 Allele frequencies were determined in the blood donor population as follows: 0.318 for HNA-1a, 0.668 for HNA-1b, 0.014 for HNA-1c, 0.768 for HNA-3a, 0.232 for HNA-3b, 0.882 for HNA-4a, 0.118 for HNA-4b, 0.736 for HNA-5a and 0.264 for HNA-5b.
22414054 HNA-3b/b genotype results for six different racial and ethnic groups showed that there could be a significant risk of producing anti-HNA-3a in Chinese, and Caucasian and Asian Indian blood donors, but low risk in Hispanic, African, or Native Americans.
22211383 HEK293 cells expressing full-length CTL2 proteins were useful in the detection of HNA-3 antibodies even in the presence of HLA antibodies.
22040064 African Americans have a significantly lower probability of possessing the SLC44A2*2 allele and may thus be less likely to form the clinically relevant anti-HNA-3a.
21564101 inherited 537T variant of CTL2 gene is located in HNA-3a allele results impaired granulocyte agglutination by four of 14 antibodies tested while 988T remains nearly unaffected.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20665236 SLC44A2 P1 and P2 isoforms with differing glycosylation are variably expressed in cochlea, tongue, heart, colon, lung, kidney, liver and spleen suggesting tissue specific differences that may influence function in each tissue.
20410607 In conclusion, choline transport in A549 cells is increased by treatment with DEX, and the increase is mediated by induction of functional choline transporters CTL1 and CTL2.
20040764 Mass spectrometric analysis of proteins immunoprecipitated from leukocytes by anti-HNA-3a provided direct evidence that anti-HNA-3a recognizes choline transporter-like protein 2.
20037594 SNP with arginine rather than glutamine at position 154 constitutes HNA-3a antigen and risk of transfusion-related acute lung injury (TRALI)
17926100 CTL2 is more widely distributed than previously described, and its prominent expression on cells facing the scala media suggests a possible role in homeostasis.

AA Sequence

MGDERPHYYGKHGTPQKYDPTFKGPIYNRGCTDIICCVFLLLAIVGYVAVGIIAWTHGDPRKVIYPTDSR      1 - 70
GEFCGQKGTKNENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRYLTYLNARSSRDFEYYKQFCV     71 - 140
PGFKNNKGVAEVLQDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKK    141 - 210
ANGVLEARQLAMRIFEDYTVSWYWIIIGLVIAMAMSLLFIILLRFLAGIMVWVMIIMVILVLGYGIFHCY    211 - 280
MEYSRLRGEAGSDVSLVDLGFQTDFRVYLHLRQTWLAFMIILSILEVIIILLLIFLRKRILIAIALIKEA    281 - 350
SRAVGYVMCSLLYPLVTFFLLCLCIAYWASTAVFLSTSNEAVYKIFDDSPCPFTAKTCNPETFPSSNESR    351 - 420
QCPNARCQFAFYGGESGYHRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWALRKPDDLPAFPL    421 - 490
FSAFGRALRYHTGSLAFGALILAIVQIIRVILEYLDQRLKAAENKFAKCLMTCLKCCFWCLEKFIKFLNR    491 - 560
NAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDFLFLLGKLLIVGSVGILAFFFFTHRIRIVQD    561 - 630
TAPPLNYYWVPILTVIVGSYLIAHGFFSVYGMCVDTLFLCFLEDLERNDGSAERPYFMSSTLKKLLNKTN    631 - 700
KKAAES                                                                    701 - 706
//

Text Mined References (41)

PMID Year Title
26601765 2015 Characterization of choline transporters in the human placenta over gestation.
26593331 2016 Genotype frequency of human neutrophil antigen-3 polymorphisms in the Yi, Han, and Tibetan populations of China.
26437811 2016 Full-length nucleotide sequences of 30 common SLC44A2 alleles encoding human neutrophil antigen-3.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772935 2015 Meta-analysis of 65,734 individuals identifies TSPAN15 and SLC44A2 as two susceptibility loci for venous thromboembolism.
25608003 2015 Risk estimation of HNA-3 incompatibility and alloimmunization in Thai populations.
25006121 2014 Spotlight on pathogenesis of TRALI: HNA-3a (CTL2) antibodies.
24846273 2014 Transfusion-related acute lung injury-associated HNA-3a antibodies recognize complex determinants on choline transporter-like protein 2.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23398146 2013 Determination of human neutrophil antigen-1, -3, -4 and -5 allele frequencies in English Caucasoid blood donors using a multiplex fluorescent DNA-based assay.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22414054 2012 Determination of neutrophil antigen HNA-3a and HNA-3b genotype frequencies in six racial groups by high-throughput 5' exonuclease assay.
22211383 2012 Detection of HNA-3a and -3b antibodies using transfected cell lines and recombinant proteins.
22040064 2012 Frequencies of SLC44A2 alleles encoding human neutrophil antigen-3 variants in the African American population.
21564101 2011 Genetic variation of the HNA-3a encoding gene.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20665236 2010 Isoforms, expression, glycosylation, and tissue distribution of CTL2/SLC44A2.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20410607 2010 Involvement of choline transporter-like proteins, CTL1 and CTL2, in glucocorticoid-induced acceleration of phosphatidylcholine synthesis via increased choline uptake.
20040764 2010 The neutrophil alloantigen HNA-3a (5b) is located on choline transporter-like protein 2 and appears to be encoded by an R>Q154 amino acid substitution.
20037594 2010 Characterization of the human neutrophil alloantigen-3a.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17926100 2007 Cochlin isoforms and their interaction with CTL2 (SLC44A2) in the inner ear.
17897319 2007 Integral and associated lysosomal membrane proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15715662 2005 Molecular characterization of the family of choline transporter-like proteins and their splice variants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14973250 2004 Identification and characterization of choline transporter-like protein 2, an inner ear glycoprotein of 68 and 72 kDa that is the target of antibody-induced hearing loss.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10677542 2000 An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.