Property Summary

NCBI Gene PubMed Count 25
PubMed Score 38.00
PubTator Score 29.55

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (5)

Gene RIF (12)

PMID Text
26671581 This study showed that SLC44A1-PRKCA fusion seems to be a specific characteristic of Papillary glioneuronal tumors with a high diagnostic value.
26601765 The differential expression pattern of CTL1 and CTL2 suggests that CTL1 is the key transporter involved in choline transport from maternal circulation and both transporters are likely involved in stromal and endothelial cell choline transport.
25466896 Reduced CTL1 expression is associated with postural orthostatic tachycardia syndrome.
23948665 NCI-H69 cells express the choline transporter CTL1 which uses a directed H(+) gradient as a driving force, and its transport functions in co-operation with NHE1.
22483272 REVIEW highlights discovery and characterization of SLC44A1, describes its expression patterns and subcellular localization and summarizes evidence for the role of this choline transporter in the central nervous system.
21185344 CTL1 is expressed in both SH-SY5Y and LA-N-2 cells and is responsible for choline uptake that relies on a directed hydrogen ion gradient as a driving force.
20410607 In conclusion, choline transport in A549 cells is increased by treatment with DEX, and the increase is mediated by induction of functional choline transporters CTL1 and CTL2.
19519661 The presence of CTL1 protein in rat and human CNS regions, where it is found in neuronal, glial and endothelial cells, suggests that malfunction of this transporter could have important implications in nervous system development and repair.
19357133 SLC44A1 mRNA and protein expression were down-regulated during choline deficiency.
16609143 characterization the 5'-flanking region of the human (h)CTL1 gene and some of the possible mechanisms of its regulation, including promoter activity, splicing, and expression
16319125 Data suggest that an impaired choline transporter-like protein-1 trafficking is the key contributing factor to reduced choline uptake, subsequent to the PMA-induced THP-1 differentiation to macrophages.
15691711 This study provides the first example of CHT1 expression in neurons which do not use acetylcholine as neurotransmitter.

AA Sequence

MGCCSSASSAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSIATGAAARLVSGYDSYGNICG      1 - 70
QKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALC     71 - 140
SYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGVMT    141 - 210
SKEIILGLCLLSLVLSMILMVIIRYISRVLVWILTILVILGSLGGTGVLWWLYAKQRRSPKETVTPEQLQ    211 - 280
IAEDNLRALLIYAISATVFTVILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWV    281 - 350
YWIMTLLFLGTTGSPVQNEQGFVEFKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAVVTYYFTRDK    351 - 420
RNLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMILMYIHSQLKGKENACARCVLKSCICCLWCLE    421 - 490
KCLNYLNQNAYTATAINSTNFCTSAKDAFVILVENALRVATINTVGDFMLFLGKVLIVCSTGLAGIMLLN    491 - 560
YQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLCFAIDTKYNDGSPGREFYMDKVLMEFVENSR    561 - 630
KAMKEAGKGGVADSRELKPMASGASSA                                               631 - 657
//

Text Mined References (29)

PMID Year Title
26671581 2015 Papillary glioneuronal tumors: histological and molecular characteristics and diagnostic value of SLC44A1-PRKCA fusion.
26601765 2015 Characterization of choline transporters in the human placenta over gestation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25466896 2015 Mechanism of choline deficiency and membrane alteration in postural orthostatic tachycardia syndrome primary skin fibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23948665 2013 Functional expression of choline transporter-like protein 1 (CTL1) in small cell lung carcinoma cells: a target molecule for lung cancer therapy.
22483272 2012 The ubiquitous choline transporter SLC44A1.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21185344 2011 Functional expression of choline transporter-like protein 1 (CTL1) in human neuroblastoma cells and its link to acetylcholine synthesis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20410607 2010 Involvement of choline transporter-like proteins, CTL1 and CTL2, in glucocorticoid-induced acceleration of phosphatidylcholine synthesis via increased choline uptake.
19946888 2010 Defining the membrane proteome of NK cells.
19519661 2009 Detection of choline transporter-like 1 protein CTL1 in neuroblastoma x glioma cells and in the CNS, and its role in choline uptake.
19448620 2009 Meta-analysis of genome-wide association data identifies two loci influencing age at menarche.
19357133 2009 The solute carrier 44A1 is a mitochondrial protein and mediates choline transport.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16609143 2006 Genomic organization, promoter activity, and expression of the human choline transporter-like protein 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16319125 2006 Impaired trafficking of choline transporter-like protein-1 at plasma membrane and inhibition of choline transport in THP-1 monocyte-derived macrophages.
15715662 2005 Molecular characterization of the family of choline transporter-like proteins and their splice variants.
15691711 2005 Differential expression and regulation of the high-affinity choline transporter CHT1 and choline acetyltransferase in neurons of superior cervical ganglia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698453 2001 Characterization of CDw92 as a member of the choline transporter-like protein family regulated specifically on dendritic cells.
10677542 2000 An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins.