Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.13
PubTator Score 1.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.800 2.0e-02
ependymoma -1.700 4.0e-02
oligodendroglioma -1.700 3.2e-02
glioblastoma 1.100 2.6e-06
group 4 medulloblastoma -1.500 1.0e-03
medulloblastoma, large-cell -2.300 1.8e-06
pancreatic ductal adenocarcinoma liver m... -1.668 5.1e-03
tuberculosis -2.900 6.3e-06
intraductal papillary-mucinous adenoma (... 2.100 3.0e-03
intraductal papillary-mucinous neoplasm ... 1.700 6.6e-03
interstitial cystitis 1.800 2.1e-04
cystic fibrosis -1.100 2.9e-03
pediatric high grade glioma 1.200 6.2e-05
aldosterone-producing adenoma -1.170 6.9e-03
ovarian cancer -3.200 2.3e-11

AA Sequence

MTNSKGRSITDKTSGGPSSGGGFVDWTLRLNTIQSDKFLNLLLSMVPVIYQKNQEDRHKKANGIWQDGLS      1 - 70
TAVQTFSNRSEQHMEYHSFSEQSFHANNGHASSSCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGD     71 - 140
EDAIVEVTPKLPKESSGIMALQILVPFLLAGFGTVSAGMVLDIVQHWEVFRKVTEVFILVPALLGLKGNL    141 - 210
EMTLASRLSTAVNIGKMDSPIEKWNLIIGNLALKQVQATVVGFLAAVAAIILGWIPEGKYYLDHSILLCS    211 - 280
SSVATAFIASLLQGIIMVGVIVGSKKTGINPDNVATPIAASFGDLITLAILAWISQGLYSCLETYYYISP    281 - 350
LVGVFFLALTPIWIIIAAKHPATRTVLHSGWEPVITAMVISSIGGLILDTTVSDPNLVGIVVYTPVINGI    351 - 420
GGNLVAIQASRISTYLHLHSIPGELPDEPKGCYYPFRTFFGPGVNNKSAQVLLLLVIPGHLIFLYTIHLM    421 - 490
KSGHTSLTIIFIVVYLFGAVLQVFTLLWIADWMVHHFWRKGKDPDSFSIPYLTALGDLLGTALLALSFHF    491 - 560
LWLIGDRDGDVGD                                                             561 - 573
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16984228 2007 SLC41A2 encodes a plasma-membrane Mg2+ transporter.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15809054 2005 Functional characterization of the mouse [corrected] solute carrier, SLC41A2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12810078 2003 The human solute carrier SLC41A1 belongs to a novel eukaryotic subfamily with homology to prokaryotic MgtE Mg2+ transporters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.