Property Summary

NCBI Gene PubMed Count 24
PubMed Score 25.53
PubTator Score 18.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 4.4e-06
medulloblastoma, large-cell 6234 1.0e-05
ovarian cancer 8491 3.2e-03
group 3 medulloblastoma 2254 4.5e-02
Disease Target Count Z-score Confidence
Esophageal cancer 30 3.088 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.900 1.0e-05
group 3 medulloblastoma 1.300 4.5e-02
lung adenocarcinoma 1.415 4.4e-06
ovarian cancer 1.200 3.2e-03

Gene RIF (13)

PMID Text
25969539 Knock-down of ZIP6 but not ZIP7 in MIN6 beta cells impaired the protective effects of GLP-1 on fatty acid-induced cell apoptosis, possibly via reduced activation of the p-ERK pathway
22317921 The connection with proliferation and migration, as well as the activation of ZIP7 by CK2, a kinase that is antiapoptotic and promotes cell division
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19246244 ZIP7 releases zinc from the endoplasmic reticulum and might be required for tyrosine kinase activation.
19023099 Observational study of gene-disease association. (HuGE Navigator)
18583420 ZIP7 is a critical component in the redistribution of zinc from intracellular stores to the cytoplasm and, as such, is essential for the zinc-induced inhibition of phosphatases, which leads to activation of growth factor receptors in MCF-7 cells
17975119 Observational study of gene-disease association. (HuGE Navigator)
15705588 ZIP7 is a functional zinc transporter that acts by transporting zinc from the Golgi apparatus to the cytoplasm of the cell
14525538 Structure-function analysis of HKE4, a zinc transporter.

AA Sequence

MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSHAHGHGHTHES      1 - 70
IWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGESGAPGIKQDLDAVTLWAYALG     71 - 140
ATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHTLEQPGHGHSH    141 - 210
SGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEE    211 - 280
KETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGIL    281 - 350
TTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL    351 - 420
PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE                         421 - 469
//

Text Mined References (28)

PMID Year Title
25969539 2015 Characterization of Zinc Influx Transporters (ZIPs) in Pancreatic ? Cells: ROLES IN REGULATING CYTOSOLIC ZINC HOMEOSTASIS AND INSULIN SECRETION.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22317921 2012 Protein kinase CK2 triggers cytosolic zinc signaling pathways by phosphorylation of zinc channel ZIP7.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19246244 2009 Zinc transporters and cancer: a potential role for ZIP7 as a hub for tyrosine kinase activation.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18583420 2008 ZIP7-mediated intracellular zinc transport contributes to aberrant growth factor signaling in antihormone-resistant breast cancer Cells.
18088087 2008 Phosphoproteome of resting human platelets.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15705588 2005 The ZIP7 gene (Slc39a7) encodes a zinc transporter involved in zinc homeostasis of the Golgi apparatus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14525538 2004 Structure-function analysis of HKE4, a member of the new LIV-1 subfamily of zinc transporters.
12839489 2003 Structure-function analysis of LIV-1, the breast cancer-associated protein that belongs to a new subfamily of zinc transporters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8812499 1996 cDNA cloning of the human homologues of the mouse Ke4 and Ke6 genes at the centromeric end of the human MHC region.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1855816 1991 Colinearity of novel genes in the class II regions of the MHC in mouse and human.