Property Summary

NCBI Gene PubMed Count 54
PubMed Score 104.16
PubTator Score 81.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
nephrosclerosis -1.127 6.8e-03
esophageal adenocarcinoma 1.200 3.1e-02
medulloblastoma, large-cell 1.300 1.1e-02
tuberculosis 1.800 2.3e-09
pancreatic ductal adenocarcinoma liver m... 1.322 1.2e-02
non-small cell lung cancer 1.265 1.9e-12
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-02
colon cancer 1.400 2.5e-02
lung cancer 1.500 1.7e-04
pancreatic cancer 1.200 3.3e-04
lung adenocarcinoma 1.300 3.6e-08
Breast cancer 1.400 1.1e-04
invasive ductal carcinoma 2.400 6.2e-04
ulcerative colitis -1.200 3.4e-05
ovarian cancer 2.300 1.9e-08

Gene RIF (31)

PMID Text
26305676 Data sho that silencing of zinc transporter ZIP4 resulted in increased bone tissue mineral density, and restoration of bone strength.
25971965 Developed is a structural model of ZIP4 by combining protein prediction methods with in situ experiments. Insight into the permeation pathway of ZIP4 is provided.
25921144 In glioma tumors, high ZIP4 expression was significantly associated with higher grade.
25882556 Studied the zinc binding properties of the large intracellular loop of hZIP4.
25391167 SLC39A4 mutations have roles in zinc deficiency
24586184 Both acrodermatitis mutations cause absence of the ZIP4 transporter cell surface expression and nearly absent zinc uptake.
24553114 The results described a previously uncharacterized role of ZIP4 in apoptosis resistance and elucidated a novel pathway through which ZIP4 regulates pancreatic cancer growth.
23857777 ZIP4 activates the zinc-dependent transcription factor CREB and requires this transcription factor to increase miR-373 expression through the regulation of its promoter.
23595627 High ZIP4 expression is associated with glioma.
23331012 resulkts indicate ZIP4 is the only zinc transporter that is significantly up-regulated in pancreatic cancer and might be the major zinc transporter that plays an important role in pancreatic cancer growth
22242765 Zinc, copper(II), and nickel can be transported by human ZIP4 when the cation concentration is in the micromolar range; nickel can bind to but is not transported by human ZIP4.
21803616 The results suggest that ZIP4 may be a tumor suppressor gene and down-regulation of ZIP4 may be a critical early event in the development of prostate carcinoma
21603979 Expression of two Zn(2+) influx transporters, ZIP2 and ZIP4, is reduced as a function of retinal pigment epithelium age.
21462106 The transporter ZIP4 is expressed along the entire gastrointestinal tract and acts as a major processor of dietary zinc
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20957146 Cell migration assays revealed that RNAi knockdown of Zip4 in Hepa cells depressed in vitro migration whereas forced over-expression in Hepa cells and MCF-7 cells enhanced in vitro migration
20587610 Observational study of gene-disease association. (HuGE Navigator)
20471814 GSPE and EGCG enhance the expression of cellular zinc importers ZIP4 (SLC39A4).
20160059 ZIP4 overexpression causes increased IL-6 transcription through CREB, which in turn activates STAT3 and leads to increased cyclin D1 expression
20023433 Overexpression of ZIP4 caused significantly increased expression of NRP-1, VEGF, MMP-2 and MMP-9 and is associated with angiogenesis, invasion and metastasis pathways in pancreatic cancer.
19755388 Knocking down ZIP4 by short hairpin RNA might be a novel treatment strategy for pancreatic cancers with ZIP4 overexpression.
19416256 results suggest that exon 9 in the SLC39A4 gene encompassing c.1438G should be screened first in the molecular diagnosis of Japanese patients with Acrodermatitis Enteropathic.
19416242 the clinical manifestations in three acrodermatitis enteropathica patients with a novel mutation
18328205 Acrodermatitis enteropathica is a rare autosomal recessive disorder caused by mutations in SLC39A4, which encodes the tissue-specific zinc transporter ZIP4.
18003899 therapeutic strategy whereby ZIP4 is targeted to control pancreatic cancer growth
17202136 ubiquitin-mediated degradation of the ZIP4 protein is critical for regulating zinc homeostasis in response to the upper tier of physiological zinc concentrations.
16986515 Zinc can regulate the mRNA expression of ZIP4 in Caco2 cells.
16682017 temporal and spatial patterns of expression of the mouse ZIP1, 3, 4, and 5 genes in the developing intestine and the effects of maternal dietary zinc deficiency on these patterns of expression were examined
12787121 Three novel mutations, 1017ins53, which creates premature termination codon, and two mis-sense mutations, R95C and Q303H.
12068297 SLC39A4 is centrally involved in the pathogenesis of acrodermatitis enteropathica.
12032886 A novel member of a zinc transporter family, hZIP4, is defective in acrodermatitis enteropathica.

AA Sequence

MASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTLADRVHCANGPCGKCLSVED      1 - 70
ALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCEDARAGLWASHADHLLALLESPKALTPGL     71 - 140
SWLLQRMQARAAGQTPKTACVDIPQLLEEAVGAGAPGSAGGVLAALLDHVRSGSCFHALPSPQYFVDFVF    141 - 210
QQHSSEVPMTLAELSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNSSSVWDTVCLSARDVMAAY    211 - 280
GLSEQAGVTPEAWAQLSPALLQQQLSGACTSQSRPPVQDQLSQSERYLYGSLATLLICLCAVFGLLLLTC    281 - 350
TGCRGVTHYILQTFLSLAVGALTGDAVLHLTPKVLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLF    351 - 420
NLLLPRDPEDLEDGPCGHSSHSHGGHSHGVSLQLAPSELRQPKPPHEGSRADLVAEESPELLNPEPRRLS    421 - 490
PELRLLPYMITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVRQALL    491 - 560
LNLASALTAFAGLYVALAVGVSEESEAWILAVATGLFLYVALCDMLPAMLKVRDPRPWLLFLLHNVGLLG    561 - 630
GWTVLLLLSLYEDDITF                                                         631 - 647
//

Text Mined References (55)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26305676 2015 ZIP4 silencing improves bone loss in pancreatic cancer.
25971965 2015 Computation and Functional Studies Provide a Model for the Structure of the Zinc Transporter hZIP4.
25921144 2015 Expression Profile Analysis of Zinc Transporters (ZIP4, ZIP9, ZIP11, ZnT9) in Gliomas and their Correlation with IDH1 Mutation Status.
25882556 2015 The large intracellular loop of hZIP4 is an intrinsically disordered zinc binding domain.
25391167 2014 SLC39A4 mutation in zinc deficiency patients.
24586184 2014 Extreme population differences in the human zinc transporter ZIP4 (SLC39A4) are explained by positive selection in Sub-Saharan Africa.
24553114 2014 ZIP4 confers resistance to zinc deficiency-induced apoptosis in pancreatic cancer.
23857777 2013 A novel epigenetic CREB-miR-373 axis mediates ZIP4-induced pancreatic cancer growth.
23595627 2013 ZIP4 is a novel molecular marker for glioma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23331012 2013 Gene profile identifies zinc transporters differentially expressed in normal human organs and human pancreatic cancer.
23228939 Two compound heterozygous novel SLC39A4 mutations in generalized eczematoid acrodermatitis enteropathica.
22242765 2012 The human ZIP4 transporter has two distinct binding affinities and mediates transport of multiple transition metals.
21906148 Acrodermatitis enteropathica: a novel SLC39A4 gene mutation found in a patient with an early-onset.
21803616 The role of zinc transporter ZIP4 in prostate carcinoma.
21603979 2012 ZIP2 and ZIP4 mediate age-related zinc fluxes across the retinal pigment epithelium.
21462106 2010 Gastrointestinal factors influencing zinc absorption and homeostasis.
21165302 2010 Congenital zinc deficiency from mutations of the SLC39A4 gene as the genetic background of acrodermatitis enteropathica.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
20957146 2010 Zip4 (Slc39a4) expression is activated in hepatocellular carcinomas and functions to repress apoptosis, enhance cell cycle and increase migration.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20471814 2011 Dietary catechins and procyanidins modulate zinc homeostasis in human HepG2 cells.
20463217 2010 Tissue plasminogen activator alters intracellular sequestration of zinc through interaction with the transporter ZIP4.
20300938 2010 One novel homozygous mutation of SLC39A4 gene in a Chinese patient with acrodermatitis enteropathica.
20160059 2010 ZIP4 regulates pancreatic cancer cell growth by activating IL-6/STAT3 pathway through zinc finger transcription factor CREB.
20023433 2010 ZIP4 upregulates the expression of neuropilin-1, vascular endothelial growth factor, and matrix metalloproteases in pancreatic cancer cell lines and xenografts.
19755388 2009 Down-regulation of ZIP4 by RNA interference inhibits pancreatic cancer growth and increases the survival of nude mice with pancreatic cancer xenografts.
19416256 2009 Novel and recurrent nonsense mutation of the SLC39A4 gene in Japanese patients with acrodermatitis enteropathica.
19416242 2009 A new genetic isolate of acrodermatitis enteropathica with a novel mutation.
19370757 2009 An update on mutations of the SLC39A4 gene in acrodermatitis enteropathica.
19021533 2008 Regulation and function of Zip4, the acrodermatitis enteropathica gene.
18936158 2009 Novel proteolytic processing of the ectodomain of the zinc transporter ZIP4 (SLC39A4) during zinc deficiency is inhibited by acrodermatitis enteropathica mutations.
18684156 2008 A novel SLC39A4 gene mutation in the family of an acrodermatitis enteropathica patient with an unusual presentation.
18328205 2007 Acrodermatitis enteropathica.
18003899 2007 Aberrant expression of zinc transporter ZIP4 (SLC39A4) significantly contributes to human pancreatic cancer pathogenesis and progression.
17573886 2007 A novel mutation of the SLC39A4 gene causing acrodermatitis enteropathica.
17202136 2007 A histidine-rich cluster mediates the ubiquitination and degradation of the human zinc transporter, hZIP4, and protects against zinc cytotoxicity.
16986515 2006 [Effect of zinc on mRNA expression of ZIP4 in Caco2 cells].
16889938 2006 A new mutation in exon 3 of the SCL39A4 gene in a Tunisian family with severe acrodermatitis enteropathica.
16682017 2006 Expression and regulation of SLC39A family zinc transporters in the developing mouse intestine.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14709598 2004 Acrodermatitis enteropathica mutations affect transport activity, localization and zinc-responsive trafficking of the mouse ZIP4 zinc transporter.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612438 2004 Zn2+-stimulated endocytosis of the mZIP4 zinc transporter regulates its location at the plasma membrane.
12955721 2003 Mutation spectrum of human SLC39A4 in a panel of patients with acrodermatitis enteropathica.
12801924 2003 The acrodermatitis enteropathica gene ZIP4 encodes a tissue-specific, zinc-regulated zinc transporter in mice.
12787121 2003 Novel SLC39A4 mutations in acrodermatitis enteropathica.
12659941 2003 The LZT proteins; the LIV-1 subfamily of zinc transporters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12068297 2002 Identification of SLC39A4, a gene involved in acrodermatitis enteropathica.
12032886 2002 A novel member of a zinc transporter family is defective in acrodermatitis enteropathica.
11254458 2001 Homozygosity mapping places the acrodermatitis enteropathica gene on chromosomal region 8q24.3.