Property Summary

NCBI Gene PubMed Count 34
PubMed Score 40.14
PubTator Score 32.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
esophageal adenocarcinoma 737 2.1e-02
Disease Target Count Z-score Confidence
Acrodermatitis enteropathica 18 3.361 1.7
Bethlem myopathy 5 3.165 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
esophageal adenocarcinoma -1.200 2.1e-02

Gene RIF (14)

PMID Text
26643924 ZIP2 Gln/Arg/Leu polymorphism involve in proinflammatory mediation and zinc homeostasis in elderly population with a more pronounced anti-inflammatory effect of zinc supplementation in subjects carrying ZIP2 Leu- (Arg43Arg) genotype
24936057 results of this study suggest that ZIP2, a zinc transporter expressed specifically in the epidermis, and zinc taken up by ZIP2 are necessary for the differentiation of keratinocytes
23921484 Data indicate that the average expression level of zinc transporter Zip2 was significantly higher and zinc transporters Zip6, Zip8 mRNA levels were significantly lower in short stature children than in health controls.
23686108 Increased expression of Zip2 gene is closely associated with immunity of pulmonary tuberculosis patients, suggesting that the Zip2 gene may play a key role in initial infection control.
21603979 Expression of two Zn2+ influx transporters, ZIP2 and ZIP4, is reduced as a function of retinal pigment epithelium age.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18328005 Zip2 Gln/Arg/Leu polymorphism plays a role in the susceptibility to carotid artery disease.
18328005 Observational study of gene-disease association. (HuGE Navigator)
18279033 Gene expression regulation of ZIPs after zinc supplementation.
17786585 regulation of ZIP2 protein in human breast cancer xenografts
17550612 ZiP2 and Zip3 are down regulated in malignant cells

AA Sequence

MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAGFMHMTAEALE      1 - 70
EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLESLALQCCPGAAGGSTVQDEE     71 - 140
WGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFHSVFEGLAVGLQPTVAATVQLCLAVLAHKGLVVFGV    141 - 210
GMRLVHLGTSSRWAVFSILLLALMSPLGLAVGLAVTGGDSEGGRGLAQAVLEGVAAGTFLYVTFLEILPR    211 - 280
ELASPEAPLAKWSCVAAGFAFMAFIALWA                                             281 - 309
//

Text Mined References (36)

PMID Year Title
26643924 Effect of ZIP2 Gln/Arg/Leu (rs2234632) polymorphism on zinc homeostasis and inflammatory response following zinc supplementation.
24936057 2014 ZIP2 protein, a zinc transporter, is associated with keratinocyte differentiation.
23921484 2013 Zip1, Zip2, and Zip8 mRNA expressions were associated with growth hormone level during the growth hormone provocation test in children with short stature.
23686108 2013 Up-regulation of Slc39A2(Zip2) mRNA in peripheral blood mononuclear cells from patients with pulmonary tuberculosis.
22209006 2012 Comparison of intracellular zinc signals in nonadherent lymphocytes from young-adult and elderly donors: role of zinc transporters (Zip family) and proinflammatory cytokines.
22079192 2011 Intrathecally synthesized IgG in multiple sclerosis cerebrospinal fluid recognizes identical epitopes over time.
21947419 2012 SLC39A2 and FSIP1 polymorphisms as potential modifiers of arsenic-related bladder cancer.
21603979 2012 ZIP2 and ZIP4 mediate age-related zinc fluxes across the retinal pigment epithelium.
21508100 2011 Endogenic regulation of proliferation and zinc transporters by pigment epithelial cells nonvirally transfected with PEDF.
20148757 2010 Intensive therapies for mantle cell lymphoma: time for a disease-specific approach?
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19598279 2009 Overexpression of Zip-2 mRNA in the leukocytes of asthmatic infants.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18385089 2008 Modulation of Nrf2-dependent antioxidant functions in the RPE by Zip2, a zinc transporter protein.
18328005 2008 A novel Zip2 Gln/Arg/Leu codon 2 polymorphism is associated with carotid artery disease in aging.
18326752 2008 Expression of ZnT and ZIP zinc transporters in the human RPE and their regulation by neurotrophic factors.
18279033 2008 Zinc supplementation in the elderly reduces spontaneous inflammatory cytokine release and restores T cell functions.
17786585 2008 Regulation of zinc transporters by dietary flaxseed lignan in human breast cancer xenografts.
17550612 2007 hZip2 and hZip3 zinc transporters are down regulated in human prostate adenocarcinomatous glands.
17473989 2007 Regulation of zinc transporters by dietary zinc supplement in breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12748861 2004 The SLC39 family of metal ion transporters.
12730457 2003 Regulation of zinc metabolism and genomic outcomes.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12002684 2002 Cellular transporters for zinc.
11831460 Eukaryotic zinc transporters and their regulation.
11590192 2001 Effects of intracellular zinc depletion on metallothionein and ZIP2 transporter expression and apoptosis.
10681536 2000 Functional expression of the human hZIP2 zinc transporter.
7751801 1995 [Subtraction cloning of growth arrest inducible genes in normal human epithelial cells].